CAZyme Information: NEUDI_167621T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_167621T0-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	NdisFGSC8579_SC007|CGC1	40040.16	8.8617

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC007:963196-964329(+)

Full Sequence      

MAASRTATRTLRALRTSTRPALTAAPRAAFRQGGRRLYSSEPAKSGGSNIWAWAIGAGAL
GAGGLWYLNQDGASATPKVFTPKFEDYQAVYNEIASRLEEKDDYDDGSYGPVLVRLAWHA
SGTYDKETNTGGSNGATMRFAPESDHGANAGLKVARDFLEPVKAKFPWITYSDLWILGGV
CAIQEMLGPQIPYRPGRKDRDSAGCTPDGRLPNATEGQDHLRKIFHRMGFNDQEIVALSG
AHALGRCHTDRSGFEGPWTFSPTVLTNDYYKLLLDEKWQWRKWNGPKQYEDKKTKSLMML
PADMALIQDKTFKQWVEKYAADNELFFKDFSNVIVKLFELGVPFTENSERWVFKTLNA

Enzyme Prediction     

No EC number prediction in NEUDI_167621T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	92	342	2.3e-61	0.9725490196078431

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	7.58e-155	76	344	1	252	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	1.09e-86	111	348	32	248	L-ascorbate peroxidase
178467	PLN02879	1.85e-72	110	341	34	246	L-ascorbate peroxidase
166005	PLN02364	3.43e-72	110	341	33	246	L-ascorbate peroxidase 1
173823	plant_peroxidase_like	1.65e-61	93	337	2	253	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC66997.1|AA2	5.11e-196	12	354	10	353
CZS76611.1|AA2	1.46e-195	12	354	10	353
QPC75741.1|AA2	4.18e-195	12	354	10	353
QKD47835.1|AA2	3.43e-194	12	357	10	356
QGI58483.1|AA2	4.87e-194	12	357	10	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2V2E_A	4.55e-90	84	356	16	289	Structure of isoniazid (INH) bound to cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae]
2V23_A	4.85e-90	84	356	18	291	Structure of cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae],4A6Z_A Cytochrome c peroxidase with bound guaiacol [Saccharomyces cerevisiae]
4A71_A	6.87e-90	84	356	18	291	cytochrome c peroxidase in complex with phenol [Saccharomyces cerevisiae]
3M23_A	1.66e-89	84	356	13	286	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M25_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M26_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M27_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M28_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M29_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2A_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2B_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2C_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2D_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2E_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2F_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2G_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2H_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2I_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]
5EJT_A	1.83e-89	84	356	16	289	Thermally annealed ferryl Cytochrome C Peroxidase crystal structure [Saccharomyces cerevisiae S288C],5EJX_A X-ray Free Electron Laser Structure of Cytochrome C Peroxidase [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SDV9|CCPR_NEUCR	9.40e-261	1	358	1	358	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|Q4ING3|CCPR_GIBZE	2.60e-196	12	354	10	353	Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=CCP1 PE=3 SV=1
sp|A4QVH4|CCPR_MAGO7	3.86e-185	34	354	36	358	Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CCP1 PE=3 SV=1
sp|Q4WPF8|CCPR_ASPFU	1.38e-167	8	355	16	364	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|P0C0V3|CCPR_EMENI	3.30e-167	3	354	4	358	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999766	0.000226

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_167621T0-p1.