CAZyme Information: NEUDI_165873T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_165873T0-p1
• CAZy Family: GH25
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	NdisFGSC8579_SC003|CGC3	53175.45	8.1477

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC003:297999-299457(-)

Full Sequence      

MIAKLVSPLGSPKLAATTAQFRNRLPTQFRRGAPLYIAVVVFVLFLLNVTLFHSGVQDTT
FVLPHASTKHNIPKYTRAEFPRKIWQTWKVNPLAFEQRDLDTARSWVGKNPSYRYEVLTD
DNDMQYVEWHFGPDGFNRPDIVNFYRSVKAAIVKADLLRYLVMYAEGGLYADIDVEALKP
LSKFVPERYNKADIDMVIGVEIDEPDWKDHPILGPKSRSFCQWTFMCKPQLPVMMRLIEQ
IMTWLNGVAKEQGVPLAEVKLDFDQIISGTGPSAFTNAIIAEMNDASENPGRPITWDTFH
DLGESKLVSRVLVLTVEAFAAGQGHSNSGNHDARAALVKHHYHASNWPSRHPRYKHPAYG
EVEQCNWVDECVKKWDENVAAWSKLSEAEQKSIIAEKERKEKEREEQRKKEEEERKKKEE
EDRKKKEQEDRRKKEEEEAKAAKEKAAKNNAGKAGEKAAKDNKP

Enzyme Prediction     

No EC number prediction in NEUDI_165873T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	101	186	9.9e-20	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.13e-21	72	309	74	310	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.36e-11	98	187	3	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB84288.1|GT32	1.20e-236	1	403	1	420
CDP31064.1|GT32	1.76e-234	1	403	151	570
CAP71672.1|GT32	1.76e-234	1	403	151	570
AEO66402.1|GT32	1.11e-229	1	403	1	398
AEO60901.1|GT32	5.16e-223	1	397	1	392

PDB Hits     

NEUDI_165873T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.31e-35	62	347	126	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	9.24e-33	63	340	77	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.54e-32	56	319	102	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	4.67e-25	73	340	89	463	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	2.45e-08	70	234	47	203	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999983	0.000016

TMHMM  Annotations     

Start	End
32	54