CAZyme Information: NEUDI_155545T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_155545T0-p1
• CAZy Family: GH142
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	NdisFGSC8579_SC005|CGC10	40478.65	5.3635

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC005:2135641-2136914(-)

Full Sequence      

MKSLQILAGIAGLASMVSPIQASTAIDPSTAAKAAIDTMNNAFYNPSEGRWSPDVAWWIS
GTALQAVLDYMHVTGSRDYLSQAHEIIVKQKVPLPWWPQGGGNFRADSTDDTGWWALAML
RMFDLTGDKQYLAIAMQDEQYIWNYWTDTECGGGIYVDIRAMTYKNAIANALYIKLAAAL
HLRMGDARYLTRALKAHQWFVKSGMINREGLVNDGLTQDKTNGVCFNNEGPTWSYLQGVV
IGGLVELFRTTQNETYIRSATTLANAVISSPQLTPPNSGVLTDYACEGTAAGCNCDQQSF
KGIFARNLGELDVLIVGRPYRTYLEQNANSAYQKARNVDNTYGTSWSGPFDGSSLANQQS
AASLWVALL

Enzyme Prediction     

No EC number prediction in NEUDI_155545T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	29	357	1.5e-81	0.8910614525139665

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.95e-43	29	362	4	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.47e-13	101	346	84	323	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
224250	YyaL	2.16e-04	116	199	474	569	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA27974.2|GH76	1.47e-235	39	369	1	331
ADI12151.1|GH76	5.21e-119	17	369	16	366
QKG20016.1|GH76	5.43e-117	32	369	29	359
AEO57624.1|GH76	1.63e-115	27	369	45	399
AEO69376.1|GH76	1.25e-114	27	369	46	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	1.75e-19	57	336	46	303	Chain A, Lin0763 protein [Listeria innocua]
6RY0_A	2.91e-12	54	306	73	329	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]
6U4Z_A	5.08e-06	43	266	155	391	Crystal Structure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q05031|DFG5_YEAST	1.21e-17	15	314	16	331	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1
sp|Q5ACZ2|DFG5_CANAL	1.50e-12	44	369	52	389	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000537	0.999428	CS pos: 22-23. Pr: 0.9781

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_155545T0-p1.