CAZyme Information: NEUDI_153167T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_153167T0-p1
• CAZy Family: GH13
• CAZyme Description: Chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1257	NdisFGSC8579_SC002|CGC8	123139.93	3.8677

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC002:781194-785025(+)

Full Sequence      

MHKSLVAAAVLAATARAHALTEPKVNVYLGQKGDAGLRDHCDQANFDYVTIGAHCDATYD
TNGTASGASHMEGKCTVTASDIKHCQEKGKKVLLSLDGAERMGSRYSLSSEAKAEEFASF
LWGAFGPYDAKWTGPRPFDHAGHRVSVDGFNFDGEIQLNSGSESAYAAMAKKLRELYNGN
GEFLLTAAPGCPLDESNFKMKAIFDNAQFDALFIQFYNNPSCEAASTHGFNYLQWEQAIA
AGMSKEAKLFIGLAGSSDAAGSGYIEPVEAADLINTYKTRSSFGGAMVLDAFRGQTLANG
MTFLDVINTAVSSPEVVGRSTEAVDRDSSEFCEDDTTLPQVPSVTEGSDGGFFTVADPSV
ITSAPSGILPSGSLPTGAVPSGDSSGLIPGSPATEDDVCEDDTTLPQVPSATGGSSGDFF
TVVDPSMITSVPSGIVPSGSVPTGVIPSGDRSDIIPGSDATGDDYCEGEDTPEDPIRSVI
APSGVMPSGSVPSSDGSEIIGSPATSLVPSGLVPSGSVPTTDGSDIIGSPATGLVPSGLV
PSGSVPTSDGSEIIGSPATGLVPSGSVPSGDGSEIIGSPATGSIPSGIVPSGSVPTGDHS
EIIDSPVTGLVPSGSIPSGIVPSSDGFEIIDTPATGSIPSGSIPTGIVPSGLVPSGSVPS
DSIPTGDRSEIIPGTPATEDDDYCEGEPEGPVHTSIIPSSVAPSGAVPSGLVPSGIVIES
TIPTGVIPSGDVPSGVVSSVVSQVTGPIDGDNAIVPSGAIPSGMIPSGVAPFGNVSTSAL
SSVGSQVTGPIDGDNAIVPSGAVPSGMIPSGVVPSGNVPTGVLSSVGSQVTGPINGHNVA
VPSGGVPSGVLPSGVAPSGVLSSDGDKVTGPTDGDNVVPTGVYSSGGVPSGVISSVVSMV
TADPINGVNTVDPSAVTAPAEEWTTSTIYATTTSTITSCAPEVTDCPAKIGQVTTVVVPV
GVTVCPVTATETAARAPTGIFTSVPVESIPAGFTTSTVYSTATSTIASCAPEMTDCAGKV
GQVTTIIVPVGVTVCPITEAFPPATSVPAAASAVPTGVAGVPAVSAPAVPTGVAGVPDVS
APAAPSGVAGVPAVSAPVVPTSDADVPAVSAPAVPSSGIPGTGVFRVATSIVSVSSVPFT
TVTVAKPTASAPGAPGAGVPAQSTAVPGFPSEIPAGGAPVPSVVNAPAAPHGTAPAGTGV
SLAPSSAASTYSMPAPPAQTEPATGSEPSEVPVTAGAGRNVVAMGVPALMAALVLAL

Enzyme Prediction     

No EC number prediction in NEUDI_153167T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	39	257	1.2e-19	0.5608108108108109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	2.13e-85	23	307	1	278	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
223021	PHA03247	1.01e-10	1042	1233	2707	2883	large tegument protein UL36; Provisional
223021	PHA03247	1.95e-10	1028	1234	2719	2919	large tegument protein UL36; Provisional
235906	PRK07003	8.11e-10	1040	1246	357	555	DNA polymerase III subunit gamma/tau.
223021	PHA03247	2.87e-09	973	1238	2687	2953	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO54851.1|CBM50|GH18	1.58e-61	4	308	5	335
AEO65134.1|CBM50|GH18	1.49e-58	11	314	8	339
CDP24384.1|CBM50|GH18	1.70e-54	10	294	7	325
VBB73572.1|CBM50|GH18	1.70e-54	10	294	7	325
CDN29912.1|CBM50|GH18	1.70e-54	10	294	7	325

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XVN_A	2.16e-36	51	291	49	286	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
2XTK_A	2.21e-36	51	291	50	287	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
4TX6_A	2.21e-36	51	291	50	287	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2UY2_A	1.46e-34	25	313	8	289	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
4TOQ_A	1.27e-27	25	296	3	264	Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum],4TOQ_B Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum],4TOQ_C Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum],4TOQ_D Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QUQ2|CHIA1_ASPNC	4.35e-35	19	324	24	353	Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=ctcA PE=2 SV=1
sp|P54197|CHI2_COCP7	2.58e-34	27	307	33	333	Endochitinase 2 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS2 PE=3 SV=2
sp|Q1EAR5|CHI2_COCIM	2.92e-34	27	307	33	333	Endochitinase 2 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS2 PE=3 SV=2
sp|Q4WEP7|CHIA1_ASPFU	1.99e-33	4	291	7	314	Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiA1 PE=3 SV=1
sp|Q873Y0|CHIA1_ASPFM	4.95e-33	4	291	7	314	Endochitinase A1 OS=Neosartorya fumigata OX=746128 GN=chiA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000242	0.999728	CS pos: 19-20. Pr: 0.9556

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_153167T0-p1.