CAZyme Information: NEUDI_151979T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_151979T0-p1
• CAZy Family: GH125
• CAZyme Description: Lysyl hydrolase/glycosyltransferase family 25

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466	NdisFGSC8579_SC001|CGC12	52266.88	6.3874

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC001:244031-245762(+)

Full Sequence      

MLLGEQTGTAAGHFSTISSSISAIIAHWRSYRHIHRITLVIFVLLTIFVLERFRSALASA
FQTSTDPIAVPGGHQENHYEPYPDANQGAGGKHEGGSNKHEQMTPEQLLKLSQKNAGNST
LGFHAIKYINMKARYDREDAMALQAYMSGLKIEDSPAVEADMIDPVGMPPTHRPGRLRTG
EKGCWRAHANIWSQMTRDRLPPILILESDAAWDIDIRAIMSRLNTHFLDFLNQINSTAVH
DPSYQSPNNHNTHGPPSYSDANPIQPNPDDPWLSEHWDLFSLGQCFEYSQDREIKLVYED
ESVPAGKEYWGKKMGKERVIRKSGGFTCTTAYAISHTGAAKLLLRSALDLDNPVDLLIRR
MVMSRDLVAYSLFPPVIAQWEYIKGIGMTERGAQSDINGGKHSDTPENADMPGWKDVQET
ASIWQTKGHHHDVAFEKMALKEAWTEIMRTEPEKLGESLWNPQTGD

Enzyme Prediction     

No EC number prediction in NEUDI_151979T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	126	357	8.2e-21	0.9723756906077348

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	5.69e-20	126	215	2	98	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	1.17e-09	129	358	7	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
225843	COG3306	2.98e-06	176	392	63	222	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI71971.1|GT25	3.57e-133	116	466	65	403
QLI64049.1|GT25	5.43e-123	108	450	81	416
ATY66624.1|GT25	2.74e-118	116	448	78	404
QLI72726.1|GT25	7.59e-114	101	447	46	385
QBZ57328.1|GT25	1.18e-72	106	448	77	443

PDB Hits     

NEUDI_151979T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8IPK4|GLT25_DROME	8.22e-06	113	355	322	512	Glycosyltransferase 25 family member OS=Drosophila melanogaster OX=7227 GN=CG31915 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999950	0.000074

TMHMM  Annotations     

Start	End
33	50