CAZyme Information: NEUDI_136208T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_136208T0-p1
• CAZy Family: GH10
• CAZyme Description: RNA-binding protein NOVA1/PASILLA and related KH domain proteins

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295		30849.51	7.9213

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC001:4629570-4630527(-)

Full Sequence      

MVAFSSILLAASTAISGVLALPGELPGQGSLFKRQTYTSSATGTHNGYYFSFWTDGQGSV
QYTNEAGGQYTAKWSGNGNWVGGKGWMPGTDRTINYTGTYSPNGNSYLAVYGWTRNPLIE
YYVVENFGTYNPSTGATRLGSVTSDGGVYDIYRTQRVNQPSIDGTATFYQYWSVRQQKRT
GGSVNMKNHFDAWTRSGLTLGTHNYQIVATEGYVSSGSSTINVGASSGGGGGGGGGGTTP
ENPGTTTTPTNPGDGGGSNCAAKWGQCGGQGWSGATCCQSGATCQAANQWYSQCV

Enzyme Prediction     

EC	3.2.1.8:61

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	46	221	5.8e-76	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	6.74e-106	46	220	1	175	Glycosyl hydrolases family 11.
197593	fCBD	4.57e-12	262	295	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	5.64e-11	263	291	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD71059.1|CBM1|GH11	1.71e-185	1	295	1	293
CDP26454.1|CBM1|GH11|3.2.1.8	1.62e-147	1	295	1	287
VBB76545.1|CBM1|GH11	1.62e-147	1	295	1	287
CAP60973.1|CBM1|GH11|3.2.1.8	1.62e-147	1	295	1	287
AHH92835.1|CBM1|GH11	9.96e-144	1	292	1	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XNK_A	4.21e-113	36	226	2	193	Chain A, endoxylanase 11A [Thermochaetoides thermophila],1XNK_B Chain B, endoxylanase 11A [Thermochaetoides thermophila]
1H1A_A	1.44e-112	36	224	2	191	Chain A, Endo-1,4-beta-xylanase [Thermochaetoides thermophila],1H1A_B Chain B, Endo-1,4-beta-xylanase [Thermochaetoides thermophila]
4XQD_A	2.59e-98	42	223	6	188	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQD_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],5ZF3_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],5ZH0_A Crystal Structures of Endo-beta-1,4-xylanase II [Trichoderma reesei RUT C-30],5ZO0_A Neutron structure of xylanase at pD5.4 [Trichoderma reesei RUT C-30]
5K7P_A	2.68e-98	42	223	7	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei]
2JIC_A	2.68e-98	42	223	7	189	High resolution structure of xylanase-II from one micron beam experiment [Trichoderma longibrachiatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G0RUP7|XYN2_HYPJQ	1.26e-103	1	223	1	222	Endo-1,4-beta-xylanase 2 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=xyn2 PE=1 SV=1
sp|P36217|XYN2_HYPJR	1.26e-103	1	223	1	222	Endo-1,4-beta-xylanase 2 OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=xyn2 PE=1 SV=2
sp|B7SIW1|XYNB_PHACH	1.23e-102	1	295	1	290	Endo-1,4-beta-xylanase B OS=Phanerodontia chrysosporium OX=2822231 GN=xynB PE=1 SV=1
sp|B5A7N4|XYN2_TRIHA	1.58e-101	1	223	1	220	Endo-1,4-beta-xylanase 2 OS=Trichoderma harzianum OX=5544 GN=Xyn2 PE=1 SV=1
sp|E7EF85|XYNB_PENOX	3.64e-99	1	295	1	310	Endo-1,4-beta-xylanase B OS=Penicillium oxalicum OX=69781 GN=xynB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000415	0.999555	CS pos: 20-21. Pr: 0.9660

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_136208T0-p1.