CAZyme Information: NEUDI_129145T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_129145T0-p1
• CAZy Family: CE4
• CAZyme Description: Chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	NdisFGSC8579_SC015|CGC1	50324.24	4.7374

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC015:547567-549098(-)

Full Sequence      

MMFSIKAAAVAVLSFSQILVDAAPAPYPTGNMTSSADGGNMTTIADTGNMTASAGSGNMS
TSAGSGGYKNVVYFTNWGIYGRNYQVTDLPADKITHVLYSFANLKEDGTVFSSDTWSDTD
KRYPTDSWNDNGTNVYGCVKQLYLLKKANRNVRVLLSIGGWTYSQTSPSRFALSASTPES
RTKFATSALTLVKDWGFDGIDIDWEYPASETEAQNFLLLLKEIRSQMDKYAAAHADNYHF
LLTMAASAGPTKYGVLESSMKEIGETLDFMNLMAYDYAGAWDKKAGHQANLYPDTENPDS
TPFSTDRAITDYIKYGIPSNKIVLGMPLYGRAFASTDGPGTAYSGVGEGSWEKGIWDYKV
LPKGSAKVFLDEKIGASWSYDEANKIMVSYDTPEMVKQKVSYIKEKGLGGAMYWEASGDR
TDADSLMAVVKNRLGSLDSEKNLLEYPDSQYDNMKNGMSS

Enzyme Prediction     

EC	3.2.1.14:58

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	68	427	1.3e-82	0.9628378378378378

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	9.75e-129	70	419	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	1.70e-128	69	419	1	334	Glyco_18 domain.
395573	Glyco_hydro_18	1.53e-93	69	419	1	307	Glycosyl hydrolases family 18.
119351	GH18_chitolectin_chitotriosidase	1.15e-84	71	414	2	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
225862	ChiA	5.58e-84	68	420	38	424	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA28688.2|GH18	2.63e-288	1	460	41	485
BAB40594.1|GH18	4.23e-178	67	458	38	423
BAB40588.1|GH18	1.71e-177	67	457	38	422
ADF57309.1|GH18	2.43e-177	67	458	38	423
ACZ63268.1|GH18	9.83e-177	67	458	38	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IGY_A	5.29e-169	68	457	16	402	Crystal structure of Aspergillus niger chitinase B [Aspergillus niger]
6EPB_A	6.78e-168	67	459	37	423	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
6YLJ_A	8.99e-166	67	459	37	423	Chain A, Endochitinase 42 [Trichoderma harzianum],6YN4_A Chain A, Endochitinase 42 [Trichoderma harzianum],7AKQ_A Chain A, Endochitinase 42 [Trichoderma harzianum]
3G6L_A	1.42e-165	67	459	20	406	The crystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea [Clonostachys rosea],3G6M_A crystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with a potent inhibitor caffeine [Clonostachys rosea]
1WNO_A	1.04e-162	67	460	4	395	Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus],1WNO_B Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9ERT9|CHI1_METRA	1.77e-172	67	459	38	424	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|P32470|CHI1_APHAL	1.51e-168	67	459	37	423	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|P48827|CHI42_TRIHA	2.83e-166	67	459	37	423	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
sp|O14456|CHI1_METAN	1.07e-163	67	459	38	423	Endochitinase 1 OS=Metarhizium anisopliae OX=5530 GN=chit1 PE=1 SV=1
sp|A6N6J0|CHI46_TRIHA	7.82e-163	67	459	38	430	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000247	0.999737	CS pos: 22-23. Pr: 0.9820

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_129145T0-p1.