CAZyme Information: NEUDI_128944T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_128944T0-p1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386		44410.81	8.2555

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC014:319197-320455(-)

Full Sequence      

MRLIFLRSAFRVAIIAIPILLALHYFVTHVLALIHIFYQHPGIAITQREVANAYLNGTLQ
ESRKAQVPKIIHQIFHNWKDPANETLPSDWEQQRRTCVDNNPDWEYRLWTSKSSLAFLAT
HYPTFLPAYLSYPHPVQRVDALRYVLLYHYGGIYLDLDNGCLPSISPSPSPSLSTGNGSN
SLDALTYFPLWVTDGGRGALSNNILAARPNHPFWGRVVAELIEGRGATPLGGWMDRLAGF
WKRWWCLWGVLRYVEISWGVGQWFLGGVWDEYHSMLQLGKEAVVRGDNTREGMVVDEEMS
GGLYRLMMDTRPGMDEWVFFTQGRGGTWDGWDNRLFKEIGDHLWISSMVLGSLVGLMGWL
ARRYWRAQRRKGYRKVKSEDMEDRSE

Enzyme Prediction     

No EC number prediction in NEUDI_128944T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	90	167	4.3e-20	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.38e-27	65	214	80	207	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.07e-19	87	161	1	79	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO56548.1|GT32	2.20e-95	16	369	13	326
CDP25656.1|GT32	1.06e-94	6	381	1	331
CAP73255.1|GT32	1.06e-94	6	381	1	331
VBB75740.1|GT32	1.50e-94	6	381	1	331
UNI16793.1|GT32	3.20e-91	34	376	38	326

PDB Hits     

NEUDI_128944T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	1.06e-34	56	355	51	285	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.38e-32	56	221	46	188	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	1.54e-31	67	355	55	277	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.12e-31	67	221	82	213	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	8.65e-23	66	221	63	199	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999695	0.000347

TMHMM  Annotations     

Start	End
12	34
343	365