CAZyme Information: NEUDI_124673T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_124673T0-p1
• CAZy Family: AA9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515		56164.66	6.6863

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC003:1539768-1541598(+)

Full Sequence      

MRIIAITALLVARQALAALQVDLKSPDSIKRAASLVASDLLSYYHGSEPGQTPGILPGPP
PAGDYYWWESGALWGTMMDYWHYTGDSSYNELITSSMLFHTGPPLNAYMPENYTISMGND
DQGFWGLSAMLAAEIGFPDPPADKPQWLQLAQAVFHTQADPGRHDDVCGGGLRWQIPMAN
IGFDYKNSISNGIFFNLGARLARYTGNETYAHHARKTWDWMMAVGLMTEDGDVYDGAHTR
VNCTDVFKAQFSYNAAVFLQGAAFMYSFTKGPEQQLWKHRVQALLDRSIAFFFRTGPMIE
LSCETPTVILCKTDMLSFKGYTHRWMASTTQLAPFTRDTIMRVLRNSTAAAVNSCRGPLH
DGRACGFRWTTGGYDGLTGAGQEMSVLAALSSLLAFNENAGGDGKPGDKGAPLTGETGGT
SKGNPHAGTGKGVVDPTELRELTRGDRVGAWILTAFTLGTLVAAFVLMASGSFEELEGEV
AAAAAAGEKKKENEKKKKLPTWYKIAREVIFRHQG

Enzyme Prediction     

EC	3.2.1.101:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	26	397	3.3e-104	0.9357541899441341

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.59e-167	28	387	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.65e-06	151	259	116	215	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA33345.3|GH76	2.95e-295	78	515	1	440
AEO63530.1|GH76	2.56e-181	27	471	27	453
CDP26028.1|GH76	2.75e-179	22	471	25	457
CAP73625.1|GH76	2.75e-179	22	471	25	457
AEO57010.1|GH76	9.65e-179	22	471	22	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.29e-146	27	447	34	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	3.96e-113	2	467	5	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	7.52e-111	19	463	22	444	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q6FLP9|DCW1_CANGA	1.02e-106	1	463	1	439	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|O74556|YCZ2_SCHPO	1.26e-103	18	413	19	408	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	8.42e-101	18	466	18	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000286	0.999689	CS pos: 17-18. Pr: 0.9545

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_124673T0-p1.