CAZyme Information: NEUDI_109505T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_109505T0-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
672		74787.14	9.4056

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC003:3004462-3006822(+)

Full Sequence      

MWPNNTFSAGWEHRTIFQNLPESVLVTNVSEAPNKMAEIERMGERFVIDMLKKDKIPVFL
PGETEYERSVANANLLYRFTRPACVVQPKNVGHVQTTVKEAKDRGVPITIKCGGHSYAGF
SATDKGISLDLLNLNRVKIDVQSNTVTLQGGALWGHAYKQLVNNRMNGFIINGGRCPTVG
VGGFLLGGGLGPFTRSFGMGCDTLKEITIVTADGNKVTVKDTDNPDSTKGRLFWALCGAG
GGNFGVVVEFKMYLQKLSNKDGSVVAGRYTWFPKSDKERTNKTKDKLMEKFMDTMNGFYA
TAWPEQVTIDTSWICDLKETSSELAVRFLVYYDGIKKDFEKLIVDKLGADKAENGGGKLA
EQLARRSMSEKSTRFLHETLVSQWSEETIKAFPTDPTFKLYSSFVFKNDLERIKKITSII
REEMAVFKSRFAGESGLLQVTWIHSGGKASRKDRSASAFRWRDGVYQTYIMLDWKEKWME
GEMRAFLRAFKDKLRPFSIMSSAAFINFPDAVLSSGTAEKTYYGNNTKNLRLVKQQWDPD
NFFKWKQGIKLPQTAEKTPAKAKRRSKTSAVPPIPAEAFNAFNMSAGASSASLGAGDAFT
INALGATERDYDRRDGLVEGDSVSSDDESPVDEQKLTDELATAQWETFTLPPARSLMNLG
SRGVLGLTDLGF

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	80	549	6.2e-73	0.9716157205240175

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.46e-23	82	214	1	133	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	3.61e-21	81	271	31	220	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	2.21e-13	504	550	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	0.010	76	154	60	146	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7214923.1|AA7	6.84e-32	47	543	29	483
AEO63154.1|AA7	3.69e-29	49	549	30	489
AEO56694.1|AA7	4.04e-29	49	549	41	497
UQC87672.1|AA7	1.83e-27	1	549	1	495
CAP73004.1|AA7	1.86e-27	49	554	30	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FYE_A	8.47e-28	61	549	25	459	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
5K8E_A	1.19e-27	43	251	22	224	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6FYD_A	2.05e-27	61	549	25	459	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
3VTE_A	2.59e-27	81	549	53	510	Crystal structure of tetrahydrocannabinolic acid synthase from Cannabis sativa [Cannabis sativa]
4UD8_A	2.90e-27	81	549	81	527	AtBBE15 [Arabidopsis thaliana],4UD8_B AtBBE15 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q796Y5|YGAK_BACSU	5.32e-30	63	549	15	442	Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) OX=224308 GN=ygaK PE=3 SV=4
sp|Q33DQ2|CBCAS_CANSA	1.56e-28	69	549	62	537	Cannabichromenic acid synthase OS=Cannabis sativa OX=3483 GN=CBCAS PE=1 SV=1
sp|O06997|YVDP_BACSU	3.31e-28	58	549	10	443	Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) OX=224308 GN=yvdP PE=1 SV=1
sp|Q9FZC8|FOX5_ARATH	1.06e-27	25	549	12	522	Berberine bridge enzyme-like 7 OS=Arabidopsis thaliana OX=3702 GN=FOX5 PE=3 SV=1
sp|A6P6W0|CASL1_CANSA	2.88e-27	65	549	58	537	Cannabidiolic acid synthase-like 1 OS=Cannabis sativa OX=3483 GN=CBDAS2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_109505T0-p1.