CAZyme Information: NEUDI_104748T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_104748T0-p1
• CAZy Family: AA6
• CAZyme Description: Nuclear localization sequence binding protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457	NdisFGSC8579_SC015|CGC5	47996.69	4.6286

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC015:112475-113848(+)

Full Sequence      

MSLLTKAALLLAVAGSALGAPALTNPGGFKNHVSAAGTTHHIPGHGTHFELPDHLKQRSI
PGGGEIDSTRTPQQQSQSQSMYTNHTYVPAEAYQNKTSTVTKRNLQALSGGDATGDKKEH
IPMPHKSSVPYVDQATGISFQRFYDEASQFSFGLALSSLPSAGDAAAAGNDATDFIAQLS
FPLNSTTGLGKGAGWGGVSISPKLTASHLPLFLGLQTDGFGNLAFSSFTEAVKSAAASGA
AATDAANVPTTADQQAASTGDKDLAFKIRTIPSATSITATHLTYTFLCEGCLSISKCAAN
LDAWKAQGKTKVLRLGWAMGDAVASEAETKADEQQNAQKWAYHRLGFGHLKIDLEGAVQH
TAEQFNGWKALATVEEVRGFEGLAPPFAMDLVNKVSNSEGAKNLEKVKGAEGEKKEEEEE
GEKEVESESESDSDSDSDSDSDCGCESDSDSDSEDEE

Enzyme Prediction     

No EC number prediction in NEUDI_104748T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA8	131	363	6.6e-20	0.9835164835164835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	1.30e-16	131	357	1	173	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
187688	CDH_like_cytochrome	2.26e-13	130	354	1	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC76824.1|AA8	7.70e-17	130	357	49	228
CZS77904.1|AA8	2.60e-16	130	357	49	228
QLI71820.1|AA8	4.06e-16	126	372	26	214
CEF74629.1|AA8	4.77e-16	130	357	49	228
CAE7012833.1|AA8	7.33e-16	105	357	31	233

PDB Hits     

NEUDI_104748T0-p1 has no PDB hit.

Swiss-Prot Hits     

NEUDI_104748T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000354	0.999597	CS pos: 19-20. Pr: 0.9780

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_104748T0-p1.