CAZyme Information: NEUDI_101489T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_101489T0-p1
• CAZy Family: GT90
• CAZyme Description: Galactosyltransferases

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605		67467.66	7.4467

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC009:833735-835552(-)

Full Sequence      

MTMKVLLFQRPTRGFSIFVTLVFISVLWSISRLRPHGSLLPTTFDKWGGIGEWKGQGGGG
EGGGRGGSSPPPGGGTPADQTTLNGAQRPYRPKLDPGQCPKDLEFLRRPELGLTDNILYS
RRCIEPIFKADFDRNTITNIAGPLVTNTTALDLTSCSHDEPIPCEPLALEVPMPYPRDAQ
YPHLLFGVASKYERMREAIPAFAHWLAGTGARLVGTIADAVPPEHQDDTTRNSFNLSLLE
EEYRAAGIIATFRPPKIFKRLNLKDGKPDPRPVPVEHHHFLVIKELLSVIDSSQSSQPPH
WLAILDDDTFFPSLSPLSHTLSRHDHTRPAWLGALSDDFQAVQAWGFMAFGGAGSFLSLP
LARQLAPHLEECITTASVQTGDGILRDCVYSHTRTRLTLVEGLHQHDIRGDPSGFFESGV
WPVLSLHHWKSWYHAPVAKMARVAKEVCGDCFLMRVRFGTDSSKDHKRRKEEESLLSLGY
SITQYPGLANGLDDIDLSRVEGTWKEAERKEKFAFSYGPLRRRLQVEKEKKSWRLVDVDI
GEEDLSSTPTQSTTTKKESGGVKEGRAWPSQRKGQKRFRQIYVHKAAGPALGESMDEVIE
LVWEV

Enzyme Prediction     

No EC number prediction in NEUDI_101489T0-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	2.16e-10	301	406	87	204	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	5.81e-10	348	428	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
215605	PLN03153	1.28e-09	301	428	213	341	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60093.1|GT31	1.65e-151	99	605	91	539
AEO67880.1|GT31	6.72e-144	99	604	54	512
QBZ53356.1|GT31	1.15e-120	96	604	81	510
CEI69250.1|GT31	3.76e-103	88	605	40	492
CZS84460.1|GT31	1.05e-102	86	605	38	492

PDB Hits     

NEUDI_101489T0-p1 has no PDB hit.

Swiss-Prot Hits     

NEUDI_101489T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000002

TMHMM  Annotations     

Start	End
13	30