CAZyme Information: NEUDI_100497T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_100497T0-p1
• CAZy Family: AA1
• CAZyme Description: Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616	NdisFGSC8579_SC008|CGC5	66772.08	5.9650

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC008:730941-732876(+)

Full Sequence      

MKFSYLSLLLTPALAAAVDADSTTTYDYIVVGSGPGGGPLSAELARAGYSTLLIEAGTDQ
GDNPTYTEIQNFNEAANDETSRWDFWVKHSDDAARDLKFKHTTWDTGDGTFYVGLDPPKG
AKLLGIQYPRAAVLGGCAMHNAGVASLPEDDDWNRIVNLTGDTSWEAGKMREYLKRIERN
EYAGANDTSHGHDGWLAISSSDPSWAKNDSNPAVKIMKRLAELIGQDPSRVADLAKTDIL
GDFPNRDTMSSLFNLATHADKTGKRYSPNNYIRATLADPAKYPLTVKLNTLATKVLFNTT
GPKPRAIGVEVMTGPSLYRADPKHVPGTTTPPPKTQYFARREVILSGGVFNTPQLLKLSG
IGPATELSRFGIPVLVDLPGVGERLTDNYEGSLLALGKVPIQSGLITILFRTPNAPTRKR
NIFAWCGAFSFEGFWPGFPAYYGPEQFSCAMVHIKPRSQDGSVRLLSADPQDKPEINFRF
FEHGGDEDLAELVSAANILRESWQAAGETVLPFEELHPCPSATEKNSTCTSSESQQAEYF
KTQAYSHHATSSCQIGADGDKMAVLDSKFRVRGTEGLRVVDASAFPNVPGFFPSVPTMMI
SVKAAGDVLAAARGGR

Enzyme Prediction     

No EC number prediction in NEUDI_100497T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	20	613	7.1e-72	0.5129449838187702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.20e-50	261	605	195	528	choline dehydrogenase; Validated
225186	BetA	5.84e-47	42	613	24	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.17e-28	456	604	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.04e-22	260	614	215	586	Protein HOTHEAD
366272	GMC_oxred_N	1.28e-08	129	390	22	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP64871.1|AA3	4.01e-304	1	610	1	612
VBB81166.1|AA3	4.01e-304	1	610	1	612
CDP29384.1|AA3	4.01e-304	1	610	1	612
QBZ53739.1|AA3	1.91e-225	1	614	59	664
QRD01027.1|AA3	1.93e-202	1	610	5	614

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	2.12e-43	22	615	10	532	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	2.12e-43	22	615	10	532	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	5.44e-43	22	615	10	532	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
6F97_A	1.98e-29	24	609	4	528	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4UDP_A	2.66e-29	24	609	4	528	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	2.80e-42	22	615	10	532	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	3.51e-39	24	609	3	531	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|A6X2G7|BETA_BRUA4	1.26e-34	27	609	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
sp|Q6UPE0|CHDH_RAT	1.51e-34	126	609	125	576	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	1.91e-34	14	608	39	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000802	0.999171	CS pos: 20-21. Pr: 0.4558

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_100497T0-p1.