CAZyme Information: NEUDI_100328T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_100328T0-p1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405		44302.58	7.2605

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC008:395250-396467(-)

Full Sequence      

MRFTIFRAAAALMAIITPTIVTAANPLQIHAHVNERTSLSPRGKFVHWEGNTTDIIIHTE
VPRLIIYYQTTHDTAGKPISMLPLVTEQNIALTHLIVCSLHISKDGNITLNDHPPTDPRY
GTLWQETQILSYAGVKIMGMIGGAAAGSFTEDTLDSADETVFNRYYGQLHETIKRYGLQG
IDIDVEQPMSQGGVERLILRLRADFGKSFIITLAPVASALTLNGWNLSGFDYRKLMLAPS
GAGKEIAFYNCQFYSGFGDAANPNQFHQIITDNAQRDMRGSLAPTQVVIGQLTNPKNGGG
FVNASTLANSIQSLRNTYGQVGGVAGWEYFNGQPGGVEEPWKWAQTMTAILRPNQVPKLK
MTTAMASKLKDIWKESAAAGVKQVPGEVKVQGFEPTVDYMAMVNA

Enzyme Prediction     

EC	3.2.1.96:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	63	290	1e-16	0.6418918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119363	GH18_CTS3_chitinase	6.38e-150	63	332	1	256	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
119349	GH18_chitinase-like	1.64e-17	64	254	1	176	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
395573	Glyco_hydro_18	2.09e-10	63	333	1	274	Glycosyl hydrolases family 18.
119350	GH18_chitinase_D-like	1.32e-07	133	327	72	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
119353	GH18_CFLE_spore_hydrolase	1.25e-06	92	235	26	165	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI74194.1|GH18	4.47e-127	60	404	28	355
QUC20309.1|GH18	3.14e-125	59	405	29	358
AIT18926.1|GH18	4.23e-122	61	405	40	365
CAL49862.1|GH18|3.2.1.96	3.96e-121	59	405	30	359
CAZ16624.1|GH18|3.2.1.96	3.96e-121	59	405	30	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AC1_X	8.19e-113	60	354	1	282	Chain X, ENDO-N-ACETYL-BETA-D-GLUCOSAMINIDASE [Trichoderma reesei]
2Y8V_A	3.10e-70	63	348	14	285	Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_B Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_C Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_D Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

NEUDI_100328T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000305	0.999674	CS pos: 23-24. Pr: 0.9754

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_100328T0-p1.