CAZyme Information: NCU11396-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU11396-t26_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438	CM002242|CGC16	47306.26	6.2642

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002242:460248-461564(-)

Full Sequence      

MFSLIHNPRTFLRFIFGIVFLMCFLTNMVSGGPLTAQHLRDAFRGHRPWKTDNNERRDDD
ITQSQSQSQSTPPPQQGSGNVIRVAASPAQIDPHGVYIRASPLYSPTDGRPDTSRIIAGF
ASTSGSDRVLRVSSSTNSGASWSPLGEITRFPSDGTHDLDNAMPLALPSGRILFAFRHHS
LSPSSSPSGGFHYTFYRLDLCSSSDGGRTWSFLSHIDQRAAASSSGNKNGLWEPFLRVAA
DGNTIQAYYSSENSADDQDNLMRYSTDEGKTWSDPPILVSSSPTAASRDGMTGVSALSSS
SSPRELICVFETTSPDGTFSIARVLSHDDGLTWGERENVYMAQGGKWAGAPQVYLVGDTL
VTSFLTNEGTDLPKIDGAYTKVVVSKDQGKTWTETGKAETVAGTGSHWPGLFSLNGTHFL
ALYSTDEMGAVSHLHSVS

Enzyme Prediction     

No EC number prediction in NCU11396-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	94	371	2e-68	0.8697068403908795

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	8.37e-11	203	406	52	251	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.21e-10	108	335	32	239	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.10e-09	92	340	71	300	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	2.05e-08	238	407	29	201	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ70572.1|GH93	1.62e-95	75	432	27	358
UKZ63990.1|GH93	2.09e-95	75	432	25	355
UKZ88867.1|GH93	8.60e-95	75	432	25	356
QYS95310.1|GH93	1.37e-93	76	432	25	356
UQC86738.1|GH93	1.38e-87	79	437	31	361

PDB Hits     

NCU11396-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

NCU11396-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.056782	0.943193	CS pos: 31-32. Pr: 0.9036

TMHMM  Annotations     

Start	End
12	34