CAZyme Information: NCU10030-t26_2-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU10030-t26_2-p1
• CAZy Family: GT50
• CAZyme Description: glycosyl hydrolase unclassified family-1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822		87852.02	4.8439

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002236:9768324-9770870(+)

Full Sequence      

MLRPTSWLSLGLYLASLTQARTSILGRQTETAPENDTPAQLITGSDGVVRLDSTSGSPAI
VTLDYNRSVEGIPTFEVLAADGDTSVFEITYGESYGALSNYMSDGPLPLAAAMDTYRVNR
YSIAEPGTKSNRLVQGAFRFQRLNLSSPGVLTLRNVGVRPTTDNTAVTQLPGSFHSDHLK
LNAIWETGARTVQMTEIEKDSTPDFWEVTSEGASVGSLAPQVLGSAAAAQLLYYNVEFKV
KPVIGGFGFTVLSDTLNSGIYISCDVANGLISAHKGSTTFDEKLAESALPSNLTGGLGAW
HTVHAVVAVTDITVSIDGIPAMKLSQTARFFGSFGLGASFGHQAIFRDLFVSTPTGDKFY
ANSLTDKSFLPDFFMGTNPVAVVVDGSRRDRIAYAGDLDIAARSALTSTHNLGSILGSLD
LLGSYQATPGFFIPNAKIQQEPLANGLDVNITGLIGYSFNLVTAVAAVFMHTGDVRFATT
WAPKVQKLLEWADSQTLDNGLFNISDASLGGDWNYYDPTQSGVVTKFNVLYAYALQETVQ
ILAAGGIEPTVYQDRLEKIREAIDTALWSDELKAYYVSEAIPTGFAQDSNALAILAGVNR
NPTHSTETILSTLSKDLMSPVGPHAFSSSVIKAGFQPYISPYASSYHLRAALASNASEAA
LELLNNLWAPIADPAHENYTGTFWETLDAEGRPGLGLSTSLCHGWATGPTAELTQYVLGI
RPTQPGWKEFAVAPLTLGLQSANGTMPTLLGTFRVAWNFSCSGLLSMEIDAPIGSSGTVS
LPTPLRTPVEQSTFMINGQAVNGKTFTVMGGTRFVLKQNRKL

Enzyme Prediction     

No EC number prediction in NCU10030-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	378	781	1.8e-64	0.7361111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	3.71e-11	719	783	1	65	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	5.00e-07	378	705	27	328	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ84142.1|GH78	0.0	113	822	1	660
AEO55772.1|GH78	0.0	41	821	31	810
UQC81548.1|GH78	0.0	30	818	36	820
UKZ58110.1|GH78	2.26e-316	10	818	10	808
UKZ83809.1|GH78	4.18e-316	39	818	4	776

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.95e-18	457	795	629	955	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	3.80e-13	384	755	331	674	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

NCU10030-t26_2-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000509	0.999480	CS pos: 20-21. Pr: 0.9791

TMHMM  Annotations     

There is no transmembrane helices in NCU10030-t26_2-p1.