CAZyme Information: NCU09737-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU09737-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: DUF1237 domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
568		63805.76	5.4871

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002239:1975633-1977466(-)

Full Sequence      

MTRATSWLSLLLPWSVPLLRPAVVEASELKWDMDQVPIKGKFDETACPDYASYATYPHRP
YSEGPLSLPFQRPHVRCRTFQSDAIEKVIKDVTSRMKNPDLARLFENTFPSTTDTTVKFH
TNGKDGKEKRKTTTVTDSPVDDDPWTSTYEEDPGKWEGPQSFIITGDILAEWLRDSTNQL
KPYQKLASKDKAIFDLILGAINTQSEYVIESPYCNAFQPPPHSGLPVTLNGQDDTVHPAF
DPSSVFECKYELDSLAHFLALANAFYAHTKSTAFLNTRWYKALDSVFDVLEAQSKSTFDP
ETGSYRRNQYTFQRRTDTGTETLNLGGIGNPLNNGTGLIRSAFRPSDDATIFGFFIPANA
QMATELKRTAALLRTTGNKKDVTRAETAEAWSKTITEGIWEHGVVHHRKYGDVFAYEVDG
YGSALMMDDANYPSLLALPLMGFVSVGDTTYQNTRKMLLEKNGNPYYLEGKEFMGIGGPH
IGLQNAWPMSLLVQAQTSDDDDEIMKCLNLVLNTSKLGLIHESIDVNWSHSYTRSWFAWA
NGVFADTILDIAKRKPHLIFKDATPYEP

Enzyme Prediction     

No EC number prediction in NCU09737-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	98	549	4.6e-162	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	98	549	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	3.15e-153	77	558	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA35203.2|GH125	0.0	1	568	1	568
AEO66735.1|GH125	7.83e-304	6	567	5	549
AEO55165.1|GH125	2.07e-296	12	567	4	547
VBB84114.1|GH125	2.65e-294	7	567	6	554
CDP30915.1|GH125	3.07e-293	12	567	4	554

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ON6_A	6.27e-88	72	551	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	1.38e-87	72	551	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	1.68e-84	72	551	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	7.93e-70	83	557	10	430	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	1.26e-69	83	550	10	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	2.03e-180	46	564	26	509	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000268	0.999702	CS pos: 26-27. Pr: 0.9553

TMHMM  Annotations     

There is no transmembrane helices in NCU09737-t26_1-p1.