CAZyme Information: NCU09672-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU09672-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: glycosylhydrolase family 16-14

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	CM002240|CGC16	33768.32	4.5980

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002240:879280-880323(+)

Full Sequence      

MGNDTLSLLLPRLFLVLSALVALAAAQSGTDCNPIKTSGCPLDIGLTNNPYGVDFTKGTM
DQASWTSVGAGSVIYTSQGAVLTLSKKGDAPTISTNWYIFFGRVEVLMRAAPGTGIISSV
VLGSDDGDEIDWELIGGNNDEVQTNYFGKGNVTLYNRGGNSAVHDVQGTRHNYTIDWQIG
QLTWYVDGKTVRTLKEEDAVGGLNYPQTPMKLRIGSWAGGDPDNAPGTIAWAGGVTDYTK
GPFTMYVERVSVTNRYPAASYSYGDMSGNWDSIVLKKDDAADGNQSKEGIVKKDGSRGVA
SATNSTSSSSSSSSSSSSSS

Enzyme Prediction     

EC	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	78	234	1.3e-70	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	2.63e-109	53	254	1	201	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	2.27e-51	69	233	2	168	Glycosyl hydrolases family 16.
185684	GH16_lichenase	1.81e-24	56	253	20	211	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185683	Glyco_hydrolase_16	2.14e-21	54	248	2	205	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
225182	BglS	3.26e-11	102	289	119	298	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD70740.1|GH16_18	7.45e-209	1	305	1	286
VBB75008.1|GH16_18	4.28e-109	11	275	10	274
CDP24963.1|GH16_18	2.44e-108	11	275	10	274
CAP60948.1|GH16_18	2.44e-108	11	275	10	274
UQC86567.1|GH16_18	2.35e-104	18	303	9	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	3.25e-94	30	273	2	242	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
3O5S_A	1.64e-12	55	233	48	218	Crystal Structure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
3WVJ_A	6.01e-12	54	219	24	188	Chain A, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]
5SV8_A	5.97e-11	77	238	32	192	Crystal Structure of the catalytic nucleophile and surface cysteine mutant of VvEG16 in complex with a xyloglucan oligosaccharide [Vitis vinifera]
5DZE_A	2.74e-10	77	217	31	170	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with cellotetraose [Vitis vinifera]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8J0P4|CRF1_ASPFU	1.40e-94	17	273	10	263	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|P53301|CRH1_YEAST	1.31e-73	31	273	39	275	Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRH1 PE=1 SV=1
sp|D4B4J2|CRH12_ARTBC	1.65e-71	18	275	17	271	Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03382 PE=3 SV=2
sp|D4ALQ5|CRH11_ARTBC	2.90e-68	12	289	2	267	Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05253 PE=1 SV=2
sp|Q5AFA2|CRH11_CANAL	3.67e-62	23	273	14	260	Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH11 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000183	0.999792	CS pos: 26-27. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in NCU09672-t26_1-p1.