CAZyme Information: NCU08024-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU08024-t26_1-p1
• CAZy Family: GH74
• CAZyme Description: mannan polymerase II complex ANP1 subunit

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481		54452.36	5.7192

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002239:3954127-3955831(-)

Full Sequence      

MLPYASSSGSKAVPRHHASGYSNGYPRGNTFEISPHRFQPRGAAPPFRRRKGLFLRLAIA
LVSLLLFGLFVWPGDSGSFSWLGSGSEDFQLETVRYYDLSNVQGTAKGWEREERILICVP
LRDAEVHMPMFFGHLLNLTYPHHLIDLAFLVSDSKDNTLAVLERELTAIQASTDPSKHFG
EISIIEKDFGQKVNQDVESRHGFAAQASRRKLMAQARNWLLSAALRPYHSWVYWRDVDVE
TAPTTILEDLMRHNKDVIVPNVWRPLPDWLGGEQPYDLNSWAESETALALADTLDEDAVI
VEGYAEYATWRPHLAYLRDPYGDPDMEMEIDGVGGVSILAKAKVFRYGVHFPAFSFEKHA
ETEAFGKMSRRMGFSVVGLPHYTIWHLYEPSVDDIKHMEQMEQERLAREKEEKEKAMKEQ
KMKESFGDATGQWEKDKNEIQNLAMQENKKAEEQPAAGQQGGPADGPANAAPKEEKKEGT
Q

Enzyme Prediction     

No EC number prediction in NCU08024-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	92	355	1.8e-125	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	5.06e-167	93	355	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE85509.1|GT62	3.00e-295	57	481	18	448
VBB84024.1|GT62	1.86e-258	1	454	1	456
UQC75883.1|GT62	7.93e-258	1	450	1	453
CAP71426.1|GT62	1.21e-253	1	454	1	430
CDP30824.1|GT62	1.21e-253	1	454	1	430

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	5.59e-61	94	391	6	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	9.83e-169	56	440	29	408	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	6.72e-167	28	405	11	390	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	2.76e-129	93	405	171	530	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	1.35e-125	86	405	68	437	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	1.90e-62	49	389	13	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999874	0.000147

TMHMM  Annotations     

Start	End
52	74