CAZyme Information: NCU07761-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU07761-t26_1-p1
• CAZy Family: GH71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		43572.12	7.6442

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002240:391184-392465(+)

Full Sequence      

MRPIFLRSVFRVAIIATPILLVLHYFITHVLALIHIFFQHPGIAITQREVANAYLNGTLQ
ESRKAPQIPKIIHQIFHNWKDPANETLPSDWDQQRHTCIDINPDWEYRLWTHKSSLAFLS
THYPTFLPAYLSYPHPVQRVDALRYFLLYHYGGIYLDLDNGCLPSIKPGSDSLDALTYFP
LWITDGGRGALSNNILAARPNHPFWGRVVAELIEGRGALPLGSLTERLAGFWKRWWCLWG
VLRYVEISWGVGQWFIGGAWDEYHRMLQLGQDVMTGKTVEGVVVDEEVSGRLYRLMMDNR
PGMDEWVFFTQGRGGTWHGWDNWLFLEIGEHLWIFSMVLASLVGLMGWLARRYWRAQRGK
GYRKVKSEDMEDRSE

Enzyme Prediction     

No EC number prediction in NCU07761-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	91	168	4.9e-20	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.99e-30	68	205	82	207	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.66e-20	88	168	1	85	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO56548.1|GT32	2.56e-99	16	358	13	326
CDP25656.1|GT32	4.97e-98	25	370	22	331
VBB75740.1|GT32	4.97e-98	25	370	22	331
CAP73255.1|GT32	4.97e-98	25	370	22	331
UNI16793.1|GT32	1.57e-91	34	365	38	326

PDB Hits     

NCU07761-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT67|IMT2_SCHPO	8.50e-38	58	332	72	296	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	4.35e-34	56	343	51	283	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	5.76e-34	62	212	51	188	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	2.44e-32	64	343	51	275	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	3.41e-26	38	212	34	199	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999928	0.000123

TMHMM  Annotations     

Start	End
12	34
332	354