CAZyme Information: NCU07487-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU07487-t26_1-p1
• CAZy Family: GH7
• CAZyme Description: periplasmic beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
870		96019.84	6.1344

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002236:448859-451692(+)

Full Sequence      

MTSLSSIAVGGGPFERDTDPNPSPSSSIDSNTTPDTDFTPMGSPFQEVAVPKNKRFLAKK
KLANLTQEEKISLLTAADFWRTKSIPEKGIPAVKTSDGPNGARGGIFVGGTKAALFPCGI
SLAATWNKALLREVGRHLAEEAKARQANILLAPTVCMHRHPLGGRNFESFSEDPLLTGKL
AAQYIKGLQERGVAATIKHFVGNEQETHRLTVNSVIAERPLREIYLRPFEIAVREAKPWA
VMSSYNLVNGVHADMNTHTLKEVLRDEWKFDGAVMSDWGGVNSTAESIKAGCDIEFPHSK
KWRYEKVMEALNKGELSQADIDRAAENVLTLVERTKGSDLTPEAAEREDDREETRELIRE
AGIQGLTLLKNEGSILPINPKTTKVAVIGPNANRAIAGGGGSASLNPYYTTLPLDSIRKV
AEKPVTYAQGCHIYKWLPVASPYCSDKTGKPGVTIEWFKGDKFKGEPVVIQRRTNTDLFL
WDSAPLAQTGPEWSAIATTYLTPKHSGKHTISYMSVGPGKLYINGKLSLDLWDWTEEGEA
MFDGSVDYLVELEMVANRPVELRVEMTNELRPLSKQKQMGMTHRYGGCRIGYKEADQIDY
LQQAIAAASSADVAIVIVGLDAEWESEGYDRQTMDLPYNGSQDRLIEAVVAANPNTVVVN
QSGSPVTMPWADRVPAILQAWYQGQEAGNALADVLFGLRNPSGKLPCTFPKRLEDTPAYH
NWPGENLEVIYGEGIYIGYRHYDRTKIAPLFPFGHGLSYTKFEYGRPSLSSRVLRENGVI
ELCVAISNVGEYDGAETVQVYVRDEKSKLPRPEKELVAFEKVALERGETKHLRMELDKYA
VGYYDTDKKGWVAEEGRFVVLVGSSAGDIK

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	84	296	8.6e-71	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.11e-89	116	870	120	758	beta-glucosidase BglX.
224389	BglX	5.66e-80	78	433	48	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.33e-60	366	739	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.79e-59	44	837	41	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.02e-48	89	331	65	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA35798.3|GH3	0.0	1	870	1	870
VBB72333.1|GH3	0.0	19	870	22	893
CDP23238.1|GH3	0.0	19	870	22	895
CAP69216.1|GH3	0.0	19	870	22	895
AEO53892.1|GH3	0.0	14	870	12	869

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.12e-186	55	869	3	828	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.66e-181	55	869	3	828	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	9.28e-155	59	869	6	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.27e-121	64	869	11	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.89e-112	62	870	8	706	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	1.92e-223	62	869	15	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1CA51|BGLI_ASPCL	2.02e-203	55	869	3	822	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	9.97e-198	59	869	7	822	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	3.96e-197	59	869	7	822	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	5.77e-197	55	869	3	823	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

There is no transmembrane helices in NCU07487-t26_1-p1.