CAZyme Information: NCU07473-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU07473-t26_1-p1
• CAZy Family: GH67
• CAZyme Description: glycosyltransferase family 28 domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1361	CM002236|CGC16	145794.49	6.3826

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002236:514584-518790(-)

Full Sequence      

MTQPPNHPQPSSPLSPLSPSVSPPPPAYGDSQDLDHISLSRAGFQAGAALTPDGRINISI
SEKNHRLSQLLAPALRNQLSGHPPPPLPTTTGPLPPPYIPTSLGGHPGQTPPPKLNVVIQ
IVGSRGDVQPFVALGQTLKQTYGHRVRVATHPVFQKFVEESGLEFFSIGGDPAELMAFMV
KHPGLMPGFDAIKTGEVTKRRKGVMEVLMGCWRSCFEAGDGTGPPPREWKKGDRNAEGVP
MGQDGWTVSSSSGTGGKPFVADAIIANPPSFAHIHCAEKLEIPLHMMFTMPWSPTRAFAH
PLANIEASNADVNITNYISYALVEMMTWQGLGDVINRFREKVLDLEPLSLLWAPGLLTRL
RIPTTYCWSPALIPKPNDWAQEISVAGFYFLDLATNYTPEPDLAAFLAAGPPPVYIGFGS
IVVDDPDALTRLILRAVAKSGVRALISKGWGGIGLTEDITQADWAPRPDQYFMLGNCPHD
WLFNRVSAVVHHGGAGTSAAGIKAGKPTVVVPFFGDQPFWGAMIAKAGAGPKPIPNKELT
AENLAAAIQEALKPETLARAKELGNKIKEEKGADEGGKSFHQFLDVDALRCSLSPSRVAT
WRVRRTKVRLSAFAAEVLVREGLLQYSDLKLFRAKEHITDGQPWDPITAVTAALVEDLGT
MAMSVADFPRGIFKAKEMKRARNLSGGNGQALGSETPADGAHGTSSPQAHGALSPESQPG
SSYFPPTAGDSAEGASRSPSDVKGKGKSVPSGTHSRNDSFRDSFKQRSTSGGGGPSTPGG
TANMSGAATPQLNPEAFSYKSARDATSSVGRLVDTGMKMPMNVCLGLARGFRNAPRLYND
DTVRPQEKVTDFASGLRVATKEFGFGVYDGLSGLVTQPMRGAEKEGAKGLLKGFAKGLGG
AFLKPGAAIWSIPAYTMQGLNAEVRKLFTGGGWMNHIMAARAQQGREEMEHATREEVRDV
VARWQEKRWEDVAKGGVQGKGKGVFSPGTSTGGASGSSGQGQTRSGVAAVVGASNDAELE
RAIQASIQQTSNGDPQEDARVEAAIRLSLAQMQQQMASQTQQPPQHSGTVPARYSDFKSP
SADMASPAAQPPAYSAEYQHHQPPPEKSSLAQAMIDEYFTGISDEEYQALIEEAVQQSIR
AQMNQQSTMSAEEEKELLKAIEASKSTYTFGDVPPPPPAYQSSGFTPIATPSIPNNGEAG
RDLEKEEEEMRKALEESERMDRERREQEEREKQEEAIVLEWVKRQSLAEERFRGGSQRGL
GGGEGSGGGGGGGSGGGGGQGQVQRQAQPQTQTQAHVPRHYQPAQVQSDSRGQGQGIADV
DADGHHGPIQMEDRDYDEEEEFRRALEESMRISGQGDTRGQ

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	219	575	6.7e-59	0.8324607329842932

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.34e-78	115	583	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.32e-40	123	584	10	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.54e-17	117	298	1	138	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	1.18e-11	410	573	224	379	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	4.21e-06	414	552	278	406	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ60461.1|GT1	0.0	25	1141	39	1124
UQC88278.1|GT1	0.0	25	1261	57	1285
AEO66120.1|GT1	0.0	24	1253	36	1209
QPC76028.1|GT1	0.0	25	1253	42	1216
QPC67286.1|GT1	0.0	25	1165	42	1163

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	7.86e-69	122	622	27	474	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.31e-68	122	622	47	494	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	7.69e-32	277	573	113	388	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	1.48e-28	115	568	1	366	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	1.04e-22	332	567	167	383	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	9.67e-114	113	584	154	574	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	3.38e-112	113	584	191	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	6.06e-77	110	585	990	1414	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q0UY53|ATG26_PHANO	7.45e-75	111	585	949	1371	Sterol 3-beta-glucosyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) OX=321614 GN=ATG26 PE=3 SV=1
sp|Q2U0C3|ATG26_ASPOR	7.57e-74	111	585	888	1310	Sterol 3-beta-glucosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=atg26 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000001

TMHMM  Annotations     

There is no transmembrane helices in NCU07473-t26_1-p1.