CAZyme Information: NCU07338-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU07338-t26_1-p1
• CAZy Family: GH55
• CAZyme Description: alpha-1,6-mannosyltransferase Och1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537	CM002239|CGC12	61173.75	8.9761

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002239:4319984-4321661(+)

Full Sequence      

MSSAFCSSSASSSVHHQPRGRHFFVLPFLLSRLWSLIHSLPSSTRQLSPPSSSRVLTLDA
TRFKGCSLVHLPVMIAKLVSPLGSPKLAATTAQFRNRLPTQFRRGAPLYIAVVVFVLFLL
NVTLFHSGVQDTTFVLPHVATKHNIPKYTRAEFPRKIWQTWKVNPLAFEQRDLDTARSWV
GQNPSYRYEVLTDSNDMQYVEWHFGPDGFNRPDIVNFYRSVKAAIVKADLLRYLVMYAEG
GLYADIDVEALKPLSKFVPERYDMADIDMVIGVEIDEPDWKDHPILGPKSRSFCQWTFMC
KPQLPVMMRLIEQIMTWLNGVAKEQGVPLAEVKLDFDQIISGTGPSAFTNAIIAEMNDAS
HNPGKPITWDTFHDLGESKLVSRVLVLTVEAFAAGQGHSNSGNHDARAALVKHHYHASNW
PSRHPRYKHPAYGEVEQCNWVDECVKKWDENVAAWGKLSEAEQKSILAEKERKEKEREEQ
RKKEEEERKKKEEEDRKKKEEEDRRKKEEEEAKAGKEKAAKKNAGKGNEKAAKDNKP

Enzyme Prediction     

No EC number prediction in NCU07338-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	174	259	3.3e-19	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.97e-19	145	382	74	310	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.44e-11	171	260	3	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB84288.1|GT32	1.30e-233	74	476	1	420
CDP31064.1|GT32	9.38e-232	72	476	149	570
CAP71672.1|GT32	9.38e-232	72	476	149	570
AEO66402.1|GT32	7.39e-223	74	476	1	398
AEO60901.1|GT32	1.03e-217	74	470	1	392

PDB Hits     

NCU07338-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.69e-33	135	420	126	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	2.62e-30	153	413	99	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	2.02e-29	129	392	102	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	4.26e-23	146	413	89	463	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	5.54e-08	143	255	47	150	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000017

TMHMM  Annotations     

Start	End
105	127