CAZyme Information: NCU07225-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU07225-t26_1-p1
• CAZy Family: GH54
• CAZyme Description: endo-1,4-beta-xylanase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		30776.42	8.1935

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002240:6198992-6199953(-)

Full Sequence      

MVAFSSILLAASTAISGVFALPGELPGQGSLFKRQTYTSSATGTHNGYYFSFWTDGQGSV
RYTNEAGGQYTATWSGNGNWVGGKGWMPGTDRTINYTGTYSPNGNSYLAVYGWTRNPLIE
YYVVENFGTYNPSTGATRLGSVTSDGGVYDIYRTQRVNQPSIDGTATFYQYWSVRQQKRT
GGSVNMKNHFDAWTRSGLTLGTHNYQIVATEGYFSSGSSTINVGASGGSGGGGGGTTPEN
PGTTTTPTNPGNGGGGSCAAKWGQCGGQGWSGATCCQSGSTCQAANQWYSQCV

Enzyme Prediction     

EC	3.2.1.8:61

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	46	221	7.5e-76	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	4.02e-107	46	220	1	175	Glycosyl hydrolases family 11.
197593	fCBD	2.01e-12	260	293	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	4.65e-11	261	289	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD71059.1|CBM1|GH11	3.97e-195	1	293	1	293
CDP26454.1|CBM1|GH11|3.2.1.8	6.74e-151	1	293	1	287
VBB76545.1|CBM1|GH11	6.74e-151	1	293	1	287
CAP60973.1|CBM1|GH11|3.2.1.8	6.74e-151	1	293	1	287
AHE13929.1|CBM1|GH11|3.2.1.8	4.86e-145	1	293	1	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XNK_A	1.44e-115	36	226	2	193	Chain A, endoxylanase 11A [Thermochaetoides thermophila],1XNK_B Chain B, endoxylanase 11A [Thermochaetoides thermophila]
1H1A_A	4.91e-115	36	224	2	191	Chain A, Endo-1,4-beta-xylanase [Thermochaetoides thermophila],1H1A_B Chain B, Endo-1,4-beta-xylanase [Thermochaetoides thermophila]
4XQD_A	1.04e-99	42	223	6	188	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQD_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],5ZF3_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],5ZH0_A Crystal Structures of Endo-beta-1,4-xylanase II [Trichoderma reesei RUT C-30],5ZO0_A Neutron structure of xylanase at pD5.4 [Trichoderma reesei RUT C-30]
5K7P_A	1.07e-99	42	223	7	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei]
2JIC_A	1.07e-99	42	223	7	189	High resolution structure of xylanase-II from one micron beam experiment [Trichoderma longibrachiatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B7SIW1|XYNB_PHACH	7.47e-106	1	293	1	290	Endo-1,4-beta-xylanase B OS=Phanerodontia chrysosporium OX=2822231 GN=xynB PE=1 SV=1
sp|G0RUP7|XYN2_HYPJQ	1.44e-104	1	223	1	222	Endo-1,4-beta-xylanase 2 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=xyn2 PE=1 SV=1
sp|P36217|XYN2_HYPJR	1.44e-104	1	223	1	222	Endo-1,4-beta-xylanase 2 OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=xyn2 PE=1 SV=2
sp|B5A7N4|XYN2_TRIHA	1.80e-102	1	223	1	220	Endo-1,4-beta-xylanase 2 OS=Trichoderma harzianum OX=5544 GN=Xyn2 PE=1 SV=1
sp|Q2PGY1|XYNA_PENCI	4.22e-100	13	223	5	216	Endo-1,4-beta-xylanase A OS=Penicillium citrinum OX=5077 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000447	0.999539	CS pos: 20-21. Pr: 0.9648

TMHMM  Annotations     

There is no transmembrane helices in NCU07225-t26_1-p1.