CAZyme Information: NCU07130-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU07130-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: endo-beta-1,4-D-xylanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445	CM002241|CGC1	48886.94	8.0130

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002241:47075-48564(-)

Full Sequence      

MKMLISTEFSAIEPFLSLFRPRSFPLLLVLLAFASTLLPLASAQLDKYAKLAGLSYFGTA
VDNPRLYNEQYMSVLQGSGEFGSLTPINAQKWKKTEEVQGVFTFAEADAIANTAKAGVGG
MKTLRCHTMVWYKGLPSWVETTYSRDDMEKILAAHIQNLAQYFKGRCYAWDVVNEAIDEN
GVFRQSPMYKAMGLDFITFSFKTAAKADPGAKLYYNDYALESPSLSPGPKISITLAMLRT
VKAQGGTVHGVGFQSHLKVGLVPARAEIVNTMQQFLEVVDEVAITELDIRHSPLKVPSTR
EMWNAQARDYGEVVGACLDVNKGYGGRKCVGVTLWDFTDKYSWVPSEIPTEGEACMWDNN
YVKKPAYWTVLNMFKAYAAGASRRRAGMDGVDDGNGTVSELDLEAAAHRGPEGLPGLGRE
QTTKTVVATTLATARRVRSTARPGA

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	48	372	3.5e-84	0.9801980198019802

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	7.74e-109	45	372	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	2.18e-89	91	370	2	263	Glycosyl hydrolase family 10.
226217	XynA	1.34e-57	26	376	9	342	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB80468.1|GH10	1.17e-130	42	386	16	346
CDP28815.1|GH10	1.66e-130	42	386	16	346
CAP67073.1|GH10	1.66e-130	42	386	16	346
AAN60060.1|GH10	3.12e-99	45	417	38	391
QBZ55005.1|GH10	4.41e-99	45	417	38	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	3.76e-87	43	367	1	310	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	4.85e-87	26	367	4	332	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3WUF_A	8.55e-78	42	370	2	308	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	2.67e-76	42	370	2	308	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3U7B_A	1.35e-70	41	372	1	322	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G4MLU0|XYN5_MAGO7	5.54e-100	45	417	38	391	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1
sp|Q8J1Y4|XYN5_MAGGR	5.54e-100	45	417	38	391	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1
sp|Q5ZNB1|XYND_TALFU	1.18e-90	29	371	7	331	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|P79046|XYN1_HUMGT	6.36e-90	41	372	17	334	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1
sp|Q9HEZ1|XYNA_PHACH	5.45e-79	41	367	90	399	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.173725	0.826255	CS pos: 43-44. Pr: 0.7481

TMHMM  Annotations     

There is no transmembrane helices in NCU07130-t26_1-p1.