CAZyme Information: NCU07076-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU07076-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: endo-1,3-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
912	CM002241|CGC6	96919.36	7.4597

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002241:238339-241210(+)

Full Sequence      

MAVTTPTVAPSPSYSCPSCKGTGSKPSPVHSSSSSPFPSKGYSQQSPPKNKRNNNNSTSK
RSDGDLFSTPISPELSIPKSIPSQPNHPAPRKGIKQSQEGGGTAIPTNKFHANFFLGSQS
STVWTHPYSLQWAKGQGSSGAWGLAVSHADASQRVFGEQDPNGSGAARWFGSPVGRADVV
LSEQGLEKGNATGGVELMTQDVKEQSIRVQLVTGGDVKLEAPVVQGMGMVTALYKQGTPV
IKSGVGWKMVTQAMGVVKTGVVKYRLVMEDGATWLLYATGGDVGAIKRGEPGGLELEVQG
NNVAVAKGSFTGMVQVAKLPGGANGTEGVADAEKLYDAACGTYATGVELSGSVDGQAGRY
TFNFQKEGLSTNSSLVMFALPHHQASFSADTASKVVSSVKLDTTTKGVAVAVVGDQWTME
EDVSKPMSMGFVPWTPETGSVKTISDSAKEYIKTVAQKELLGTSQGQDILNQTDQPSMYF
GGKALAKFAAILVAVNDVLGETDMAKKGLEQLKVAFARYSENQQQYPLVYDQSWGGIVSS
ASYTTGDAGVDFGNTYYNDHHFHYGYFIYTGAVLAHLDPSWASTASNLAYVNSLVRDVAN
PSSSLDPHFPSFRTFDWYHGHSWAHGLFESSDGKDQESSSEDSMHVYALLMWAQATNNQA
LYQRSALQLSLLSRSLNSYYLYSSSNPSSQIQPKEFVGNKVAGILFENKIDHVTFFGNKQ
EYIQGIHMLPLMPHTLFVRNREFVKEEWEAFFAGGAAEKAEGGWKGVLYGNYATIDPRGA
WEVFTGGSQLVGSPGSGNGNGNGTTVTGTGTGTGTGMVESMTSTASTASTTTTPGSTTPT
STSVPTTPSAMSSKMVRRTIRRALEKGKGKMNMPLARAALPKAKKDGFGPENIDGGASLT
WYLTWCATLGGL

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	94	786	1.8e-214	0.9533762057877814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	57	784	45	729	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	443	788	1	333	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	4.06e-121	87	436	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA31105.1|GH81	0.0	1	912	1	912
AEO64126.1|GH81	4.35e-258	60	785	163	847
VBB80051.1|GH81	1.92e-247	65	789	252	932
CAP66697.1|GH81	2.12e-247	65	789	252	932
CDP28432.1|GH81	2.12e-247	65	789	252	932

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	7.48e-84	62	781	3	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.22e-83	62	781	28	719	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.32e-81	62	781	3	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	3.77e-27	104	780	34	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	4.38e-24	482	749	364	624	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	2.62e-198	65	784	192	876	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	8.54e-140	66	784	7	676	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.09e-135	60	785	41	712	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	2.10e-126	59	785	68	753	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	4.77e-123	105	785	434	1086	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000001

TMHMM  Annotations     

There is no transmembrane helices in NCU07076-t26_1-p1.