CAZyme Information: NCU07035-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU07035-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: bacteriodes thetaiotaomicron symbiotic chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1011	CM002239|CGC3	112587.38	6.1588

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002239:4984084-4987250(+)

Full Sequence      

MLPEQIPYGYYTDIIFSFATIDPNSFEIKPGDSKTADYMQRISAIKLIQPDIRIWIAVGG
WAFNDPGPTQTTFSDIAASSANTEKFIDSLVKLMNKYGFDGIDIDWEYPVAEDRSGRGAD
YKNFVTFQKALYDRMKGGGLKKQVSLTLPASYWYLQHFDIVNLEKYVDWFNVMSYDMHGS
WDIDNKWTGPYANSHSNMTEIQQALDLLWRNNIKPAKVTFGMAFYSRSFALTSPSCNTPG
CPISSGGNAGKCSGTTGVLLHAEIQDEISARKLTPTLHREAAVKSVSWGDQWVTFDDAAT
WRLKANIIRGQCIPGVMVWAMSQDDKEGTNIKALTSAVGRKQMALPNFVIKEPVRDLPQP
VKTCRWSGCYAGCPDGFKAVQRDGHKEAMLSTENCLADGVSVFCCPSDQDLPVCTWRGHK
NSGACSPGCNSGEVSVGSLRVGCSSKHQSACCTNVASTASYGMCKWVGGAPTCNTDCPSD
FPNKIVSTNTADGGEQPCISGNKHYCCQNPTPADFTNCEWVKKADPPKFPGKDFICEDVC
GPDRIKVATEVTNPYSGTNSGCYGGAWAYCCKPPAALVPRGDGDPYGGVQNKEFQTLLED
YMQNPTCPATVLFVDPGDMFTGAANQKRSLELEAAKHRVLYGRASDCKLDHYLRLAQFAA
VMLTAADSILRQFSVVWNDIFAGHYDTILEADNLRTYYNQHPDSLDPHSLINYVLLNPLR
AGPGIRGNQRTEQAFCHYVGTRRKRDVQLRSSSTGVQLFSRIVWWMEAGNNGQPFIGNIL
EGILAGHLSPHYARWQWIRGTRAGPMLELAYWIGPNPGQPSGTNYDQYRDTHTLNHGEPD
RWVVFHFHINADFDNYPYLREVNGHTYIGVQSIQVFHAHEFDSSSGGGAWRVQGNVNVDT
RVRRDGFVCPEDELWYIGTDEGLPSGSDALQRNLRQWAQSLFNDGYLASESIALIMRDLV
FYNNGEINVEDSENAYFMGYADLNPNYQQSMYTINWVRRYGTFYFSPSPPQ

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	4	333	2.2e-62	0.8817567567567568

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	3.80e-70	1	324	16	334	Glyco_18 domain.
395573	Glyco_hydro_18	2.06e-64	6	324	18	307	Glycosyl hydrolases family 18.
119357	GH18_zymocin_alpha	3.67e-63	1	320	18	341	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
119351	GH18_chitolectin_chitotriosidase	5.97e-63	2	329	19	346	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
119365	GH18_chitinase	4.27e-52	3	324	18	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA32938.3|GH18	0.0	1	1011	1	1011
UQC79326.1|CBM18|GH18	0.0	1	1010	134	1135
UKZ69147.1|CBM18|GH18	0.0	3	1011	144	1146
UKZ88270.1|CBM18|GH18	0.0	3	1011	136	1138
AIT18899.1|CBM18|GH18	5.68e-294	1	1011	132	1169

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUS_A	3.30e-39	2	409	22	421	Crystal structure of a insect group III chitinase (CAD2) from Ostrinia furnacalis [Ostrinia furnacalis],5WVH_A Crystal structure of an insect group III chitinase complex with (GlcNAc)6 (CAD2-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
5WVF_A	3.61e-38	2	409	22	421	Crystal structure of a mutant insect group III chitinase (CAD2-E647L) from Ostrinia furnacalis [Ostrinia furnacalis],5WVG_A Crystal structure of a mutant insect group III chitinase complex with (GlcNAc)5 (CAD1-E647L-(GlcNAc)5) from Ostrinia furnacalis [Ostrinia furnacalis]
1WAW_A	2.25e-37	2	417	21	445	Chain A, CHITOTRIOSIDASE 1 [Homo sapiens],1WB0_A specificity and affinity of natural product cyclopentapeptide inhibitor Argifin against human chitinase [Homo sapiens]
5HBF_A	4.08e-37	2	417	42	466	Crystal structure of human full-length chitotriosidase (CHIT1) [Homo sapiens],5HBF_B Crystal structure of human full-length chitotriosidase (CHIT1) [Homo sapiens]
1LG1_A	7.88e-36	2	328	21	346	Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose [Homo sapiens],1LG2_A Crystal Structure Of Human Chitotriosidase In Complex With Ethylene Glycol [Homo sapiens],1LQ0_A Crystal Structure Of Human Chitotriosidase At 2.2 Angstrom Resolution [Homo sapiens],6ZE8_A Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_B Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_C Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_D Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_E Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_F Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q13231|CHIT1_HUMAN	1.67e-36	2	417	42	466	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|P09805|KTXA_KLULA	1.91e-36	1	272	398	660	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|Q9D7Q1|CHIT1_MOUSE	4.22e-31	3	360	43	400	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
sp|Q9WTV1|CH3L1_RAT	2.87e-30	3	329	41	360	Chitinase-3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chi3l1 PE=2 SV=3
sp|A0A072VEP0|CHT5A_MEDTR	3.34e-29	3	339	53	383	Class V chitinase CHIT5a OS=Medicago truncatula OX=3880 GN=CHIT5A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000002

TMHMM  Annotations     

There is no transmembrane helices in NCU07035-t26_1-p1.