CAZyme Information: NCU06166-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU06166-t26_1-p1
• CAZy Family: GH31
• CAZyme Description: Alpha-1,2-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	CM002242|CGC12	56626.59	9.3655

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002242:1584200-1585711(+)

Full Sequence      

MGYHHRTSSRLGTLPLAFDLPARVGQIFMLQFRRLRRSGRNGRRIKLLLKFALPLLVLYL
IDLPIHLYRTRVARPHQDLDQPFATGCLDPSVTAAQPRENATFVMLARNSEIEGAKATVA
NIERQFNRWFHYPIMFLNDAPWSEEFKDVLSRAVSNGTEVRFEVIEKGKWGFPEEMNEKE
KTKARLQMKKQGERGVGYGDMESYHHMCRFYSGEFYNLEALRPYKWYWRLEPSVRYSCAL
TYDPFAEMARHDKVYGWTIALWEVGDTCPSLFKTTDDYRIEKGIPRTPTWNALLQVMWFP
APVRWFLGLFRVREHDNSGNKWNMCHYWSNFEIANLDFFRGREYQDYFRYLDSKGGFYSE
RWGDAPVHTLAVHMLLPPEKIHHFSDIGYEHDTLWQCPGNAPMDQQLLGNKALRDMGRMT
LPSEGGTGCRCKCQENKRRRNINSQCTSELTRPVAFHRPSWWERHNGVYHYAVNNPNNPR
K

Enzyme Prediction     

No EC number prediction in NCU06166-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	98	392	5.7e-112	0.9926739926739927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227353	KTR1	5.74e-121	80	449	58	385	Mannosyltransferase [Carbohydrate transport and metabolism].
396385	Glyco_transf_15	9.01e-102	90	392	34	312	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO71870.1|GT15	3.15e-172	36	476	13	448
CAP70932.1|GT15	4.08e-157	33	473	14	457
CDP27528.1|GT15	4.08e-157	33	473	14	457
VBB78273.1|GT15	1.16e-156	33	473	14	457
CAE85598.1|GT15	3.47e-150	50	463	25	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1S4N_A	1.94e-76	88	398	16	301	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]
7BOO_A	1.45e-64	93	402	61	353	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]
5A07_A	2.72e-63	102	404	106	393	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94565|OMH4_SCHPO	1.16e-87	43	397	27	401	O-glycoside alpha-1,2-mannosyltransferase homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh4 PE=3 SV=2
sp|Q96WW1|OMH5_SCHPO	8.14e-86	67	397	51	383	O-glycoside alpha-1,2-mannosyltransferase homolog 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh5 PE=3 SV=2
sp|P40504|KTR7_YEAST	1.51e-85	78	447	64	472	Probable mannosyltransferase KTR7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR7 PE=1 SV=1
sp|P53966|KTR5_YEAST	2.01e-79	80	401	63	432	Probable mannosyltransferase KTR5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR5 PE=1 SV=1
sp|P46592|MNT2_CANAL	3.71e-77	101	400	142	417	Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT2 PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999935	0.000072

TMHMM  Annotations     

Start	End
47	66