CAZyme Information: NCU06057-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU06057-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: GPI mannosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487	CM002242|CGC11	54029.30	10.4145

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002242:1951924-1953387(+)

Full Sequence      

MATTSPAAPRPKSKSSSLLSTLFSRPLPLYVSAFLLRIVLLLYGLWQDANSPLKYTDIDY
LVFTDAARFVSRGESPYARETYRYTPILAWLLLPTTWTAGAQWGPWAAKVINVAWFSFGK
VLFAAADLVAGWLIEQVLVMGKDFPSSAAKGKEKDTEKTKEGGKKGPSVTASTGMDPSRA
RAFAAIWLLNPMVATISTRGSSEGLLGVLVMALLWAVLSRRITLAGLLLGFSVHFKIYPF
IYAPAIVWWMDQERLSGVRAGGGGGGGGQKKTSSSFRKTLTRFLTLPRLLLAFTSLATFL
SLNFLMYRLYGHPFLQETYLHHVTRIDHRHNFSPYNTQLYLSSASVSPSHSAAEPKFKIE
SLAFLPQLVLSTILIPLTLAKKDLPTSLLAQTFAFVTFNKVCTSQYFLWYLVLLPLYLPR
SSFWTSKRMGLVALGLWVLGQALWLQQAYELEFLGRSTFLPGLWMASLGFFVVNCWILGV
IVGDGGR

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	196	482	5.2e-99	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	6.96e-81	29	482	11	415	GPI mannosyltransferase
252941	Mannosyl_trans	4.25e-69	196	482	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB81264.1|GT50	2.62e-205	9	484	10	441
CAP65259.1|GT50	3.50e-203	13	484	18	441
CAD60578.1|GT50	3.50e-203	13	484	18	441
CDP29471.1|GT50	3.50e-203	13	484	18	441
QBZ54528.1|GT50	4.36e-186	7	484	2	426

PDB Hits     

NCU06057-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7S4Z3|GPI14_NEUCR	0.0	1	487	1	487	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	2.54e-171	23	487	7	410	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	4.60e-170	19	484	1	409	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	3.48e-169	19	486	1	429	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	9.28e-165	19	486	1	422	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999995	0.000004

TMHMM  Annotations     

Start	End
27	46
112	134
196	218
225	247
284	306
361	380
395	417
429	446
461	483