CAZyme Information: NCU04938-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU04938-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
671		72953.99	4.4310

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002239:801988-804003(+)

Full Sequence      

MIFHHLLGLALAATPLALAVELTGYEYIVVGSGAGGGPLAARLAMAGHKTLLIEAGNDQG
NNVNVTVPAYSTRATEDEKLSWAFYVRHYPDDEQQARDWKTSYRLPNGTIYTGLSPPEGA
EMLGTFYPRAGTLGGCTAHNALLAVYPFQSDFQYIADLTGDDGWLPDNMRQHFIALEDKN
YPQGGYYGHGQDGWLSIELPTLTTPDSELSSLVVGGAYALGNATDSPISLTSLATNDLNA
DTIARDHDPSYNGIPISTRNGTRNGSRDFVVAVRDALNPDGSKKYPLDVRLNCFVTKITF
DDTDWDETGEPVATGVEFLDGEYLYRASPLSSSSSSSSKHAKHGGKHSNGTPGSAKASRE
VIISGGTYNSPQILKLSGIGPQDELTKFGIPVVVDLPGVGGNLQDHYEISVNVKVPQDWT
VLENCTFLLFDNTTDPCLDRWENPVMGNRGTYASNGVPVVMLYKSSAAEGDDWDLFTFGG
PLNFAGYYPGYSVDLVAEHNWWTWAILKAHPRNRAGTVTLRSSDPLDTPEINFNYFEYGS
GDYEADLTAMREGICLARDALRRSGVCTQEVRPGADIQSDEDLDQYIIDDAWGHHASSTC
PIGPDGDPMAVLDSKFRVRGVKGLRVVDASVYPRIPGTFTQISTYMVAEKAACNILEGLE
NEEVDDGYWRV

Enzyme Prediction     

No EC number prediction in NCU04938-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	24	657	3.2e-94	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.82e-66	25	656	6	532	choline dehydrogenase; Validated
225186	BetA	3.75e-65	25	657	8	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.45e-36	511	651	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.04e-14	25	656	56	577	Protein HOTHEAD
366272	GMC_oxred_N	1.56e-10	125	408	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB76690.1|AA3	2.91e-309	7	656	9	641
CDP26593.1|AA3	1.67e-308	7	656	9	641
QMW33146.1|AA3	3.60e-303	1	659	1	645
QRD84722.1|AA3	3.60e-303	1	659	1	645
QMW45179.1|AA3	3.60e-303	1	659	1	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZH7_A	1.14e-44	25	652	8	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	1.14e-44	25	652	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.14e-44	25	652	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS2_AAA	1.14e-44	25	652	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	1.42e-44	25	652	24	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q48CM7|BETA_PSE14	4.20e-45	25	655	7	535	Oxygen-dependent choline dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=betA PE=3 SV=1
sp|Q4ZM63|BETA_PSEU2	7.85e-45	25	655	7	535	Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=betA PE=3 SV=1
sp|Q88CW6|BETA_PSEPK	1.24e-43	25	655	5	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=betA PE=3 SV=1
sp|A0A248QE08|FAP_CHLVA	1.51e-43	25	652	84	633	Fatty acid photodecarboxylase, chloroplastic OS=Chlorella variabilis OX=554065 GN=FAP PE=1 SV=1
sp|A5WA97|BETA_PSEP1	1.69e-43	25	655	5	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000477	0.999483	CS pos: 19-20. Pr: 0.9707

TMHMM  Annotations     

There is no transmembrane helices in NCU04938-t26_1-p1.