CAZyme Information: NCU04623-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU04623-t26_1-p1
• CAZy Family: GH13|CBM20
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1020		112117.62	6.3189

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002240:1448048-1451212(-)

Full Sequence      

MRFANKGFESFAYALLLLSSGRQYVLGASDTPSAWPIQGNDLQDQIQWDHYSIIINGERL
FLFGGEMHPFRLPVPELWQDVLEKVKAMGMRMISIYTHWGFHAPTPDQTDFSTGAHNLTR
FFEMAKEVGLYVLVRPGPYINGELNAGGLALWSTTGSYGELRSNGSAFTEAWTPYQTGIA
KLVKPFQLTDGGTVIMYQLENEYGEQWKNVDAKIPNPKAVSYMEKLKENAIENGIVVPSV
HNAPNANGRPWSRDYDTVGAGGDVDIYGLDSYPQCWSCVTEECGNNILPFAVSNYHDHFQ
LVSPNQPSFMPEFQGGAMSPWLSPAGGCAERTGPEFVNFYYRDNIAQRITILNLYMIYGG
TNWGWLAAPFLGSSYDYGAAISEDRNIGSKYYEIKNLGLFTRAADELAYTDRVGTGTNYT
NNTNIFTTELKNPKTGARFYVLRHATTSSDSTETFAINVTTSLGSFYVPRIAPCPKLVGH
EGKIFVADFHFGKHTLFYATTEVLTYSVINQKTTLVLWTPIGISGEFYLKGAKKGTLTSS
SKGQTAVFDGQDDGVVVGFTQREGATVLEFDNDVRVVLVDRDTAYKTWVPALTKDPKVPV
DKTAIVVGPRLVRSASVQGNTISVKGDCNDTTGIEVFTSSHVSTIKWNGKQLRTTQTNYG
TLKASLQAPARFSAPKFASWKSQDSLPETAVGYSDDGPAWVIANHTTTYSATKGTVPYLF
SDEYGFHTGIRLWRGHFSGEFGATGVYLTIQGGTAHSWSAFLNGKFLGSYTGNPTVAASN
ATLSFANVPIFTNQTNVLLVMHDDTGHDQLSAALNPRGILNATLLSSNSSTTPKFNLWKL
AGTAGGFDPSRSTLDPLRTHYNEGGLSAERLGWHLPDFDDSNWSSPLTSPAQGFTGATIR
FYRTSLPLNVPKGVDASFAFKFTPVDTSNLNYRAFLYVNGYQYGRYYPSIASENVFPVPA
GVLNLGGDNVIGLAVWAQTEKGAKVDVELVTRYAVESSFESRFDGTYLQPGWTKERLDYA

Enzyme Prediction     

EC	3.2.1.-:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	54	397	4e-85	0.9837133550488599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	1.36e-119	52	398	1	315	Glycosyl hydrolases family 35.
198097	BetaGal_dom2	5.89e-64	406	587	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
402180	BetaGal_dom2	1.10e-54	429	586	23	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
166698	PLN03059	4.36e-35	46	383	30	323	beta-galactosidase; Provisional
404274	BetaGal_dom4_5	1.50e-29	868	980	2	110	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD37064.1|GH35	0.0	1	1020	1	992
BCS19904.1|GH35	0.0	29	1020	28	1017
AOV94179.1|GH35	0.0	15	1020	9	1014
BCR96126.1|CBM67|GH35	0.0	16	1020	10	1015
CAK37216.1|GH35	0.0	15	1020	9	1014

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	5.20e-171	42	998	2	952	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
3OG2_A	2.86e-163	42	985	22	970	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
5IFP_A	7.81e-162	19	986	19	975	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	2.15e-161	19	986	19	975	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	8.34e-152	36	985	36	972	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WRD3|BGALB_ASPFU	0.0	15	1020	9	1015	Probable beta-galactosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacB PE=3 SV=1
sp|B0XNY2|BGALB_ASPFC	0.0	15	1020	9	1015	Probable beta-galactosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacB PE=3 SV=1
sp|B2W791|BGALB_PYRTR	0.0	25	1020	25	1009	Probable beta-galactosidase B OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) OX=426418 GN=lacB PE=3 SV=1
sp|B6GW04|BGALB_PENRW	0.0	35	1020	29	1013	Probable beta-galactosidase B OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=lacB PE=3 SV=2
sp|A1D199|BGALB_NEOFI	0.0	13	1020	5	1015	Probable beta-galactosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.005639	0.994327	CS pos: 27-28. Pr: 0.9522

TMHMM  Annotations     

There is no transmembrane helices in NCU04623-t26_1-p1.