CAZyme Information: NCU03914-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU03914-t26_1-p1
• CAZy Family: GH11
• CAZyme Description: glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
903		103498.13	8.9784

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002241:2124382-2127222(+)

Full Sequence      

MPPPRDSSPERDYRPRRQSAQRRSRNSSAVRNSDDNGERGERAGREPRRRSRRPEPGTSV
PPITRGEPRGESSNGSSATLSAAALAQLNKQNAKRKASPKKEVKRALERSYDAQSERDVA
WEREQERERERMREARRESRMRREKEREREQQEKERERERERVRERERERERDRERERQR
GRAKPPRVATVESEDEYRYAPSRKPRDSRDAARDDRTRPKPRIMPPDSDDEYQYLTAKKR
EERARKRAPAMESDDEYQRLTPHRRTDSDDKGYRVVDARPDKPKSYERLRPDNRAGEDRS
RLRVASGPMLEQGIRARNVSGGMLEKGGFMARFQNLRGGHGGPSMSSSSGYESVDKMSDD
IGSSPPKRKRKKLWIAVGIGVVIVIIIIIIAVTVSKKKSDDGDGKGSNDTPSQGLGDISP
DDIPADAPAWLNPFKWADTTDFNLTYTAQTVGDLPVMGLFSQWDDSKAANDQVPALNKPW
GDYSKRPARGVNVGGWLSLEPFITPSLFAYDLRLGIVDEYTLCTHLGSRCESVFEKHYAT
FVTEQTFKEIADAGLDHVRIPFSYWAVQTYDGDPYVFRTSWRYLLRAIEWCRKYGLRVNL
DLHGLPGSQNGWNHSGRQGYIGWLNGTDGDLNAKRSLEIHDRLSKFFAQDRYKNIISHYG
LANEPKMTFLSVDAVLQWIEDAYALVRKNGVKDAIVVFGDGFRGLANWQGELQDLGDGAA
LDVHQYVIFNTNQIVYKHHDKIKYACEGWTEQTELSMDRSRGYGPTLVAEWSQADTDCAK
YLTNVGWGNRWTGTLLTGSESSDVSTPRCPYTDSRCDCIAANAPPDQWSDDYKTFLKMFA
EAQMYSFEKGWGWFYWLWDTEDAYQWSYKKGLAAGVLPEKAYQRDFNCDVSKIPSFDNLS
EAF

Enzyme Prediction     

EC	3.2.1.58:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	536	861	4.9e-103	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.07e-47	489	879	19	383	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	3.37e-06	541	726	24	195	Cellulase (glycosyl hydrolase family 5).
397943	Radical_SAM	0.001	539	607	83	150	Radical SAM superfamily. Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerisation, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation.
273721	SF-CC1	0.006	202	304	7	117	splicing factor, CC1-like family. This model represents a subfamily of RNA splicing factors including the Pad-1 protein (N. crassa), CAPER (M. musculus) and CC1.3 (H.sapiens). These proteins are characterized by an N-terminal arginine-rich, low complexity domain followed by three (or in the case of 4 H. sapiens paralogs, two) RNA recognition domains (rrm: pfam00706). These splicing factors are closely related to the U2AF splicing factor family (TIGR01642). A homologous gene from Plasmodium falciparum was identified in the course of the analysis of that genome at TIGR and was included in the seed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB91690.2|GH5_9	0.0	1	903	1	903
AEO58846.1|GH5_9	1.09e-298	415	903	298	785
VBB79958.1|GH5_9	2.99e-282	415	903	354	842
CAP66605.1|GH5_9	4.31e-280	415	903	354	845
CDP28338.1|GH5_9	4.31e-280	415	903	354	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.68e-68	482	886	3	387	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PB1_A	5.26e-68	477	886	5	393	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
1CZ1_A	8.51e-68	482	886	3	387	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3O6A_A	9.77e-68	477	886	4	392	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	1.39e-67	477	886	5	393	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CTI3|EXGD_ASPCL	5.44e-195	410	903	341	830	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgD PE=3 SV=1
sp|B8NNK9|EXGD_ASPFN	9.60e-190	415	903	347	831	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgD PE=3 SV=1
sp|Q2UMV7|EXGD_ASPOR	9.60e-190	415	903	347	831	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgD PE=3 SV=2
sp|Q0CHZ8|EXGD_ASPTN	2.37e-189	412	903	351	838	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgD PE=3 SV=1
sp|A1DMX4|EXGD_NEOFI	1.17e-188	287	903	219	834	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

Start	End
373	395