CAZyme Information: NCU03188-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU03188-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: sugar 1,4-lactone oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556	CM002236|CGC15	62600.14	7.3824

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002236:4851226-4852896(-)

Full Sequence      

MATESNPALASLPSNVREIIELASQRDGGIPFRAKTAHVHRTWAGTFTSLPELYIQPESV
SEIQKVVRLARHARRRVTTTGCGHSPSDITCTSSWLVNLDNFNKVISVDHLTGLVVVQAG
IRLYQLSDELDRRGLALPSLGSINEQSIAGAISTGTHGSGIKHGLVGESITELKITLANG
ETLSCSPEDKPDLFRAALISLGALGIITEVTFKAVPAFSLAWSQAIDSDKRIFEKWEKDL
WSQAEFVRIWWFPYMRRAAVWTANVVDPVDLKTGAVKHREPPTSYYDSWLGYYVYHNLLA
LSRWIPRITPWIEWFVFGMQYGFKNGEVTRIGAVQPSQKAFLLNCLYSQSVNEWAIPLHK
GPEALQRLGAWLQNLKPGDPGYVEHGIPYSAEGLWVHSPVEVRASDSTVYTSREANTRPF
LDPTQSDGPTLYLNAIMYRPYHREPTYNATERYYLGFEWLMRELGGKPHWAKTFTATQAD
LARWYGDDFQRWGAVRESVDPEGMFVGPWHRRYLLEPLQRDRLLPLEEIQQTTKKVPARQ
GGGIEVIGIQNLVAPN

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	42	238	1.2e-29	0.4388646288209607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273751	FAD_lactone_ox	5.66e-138	39	505	3	435	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.
397924	ALO	7.08e-115	210	513	1	259	D-arabinono-1,4-lactone oxidase. This domain is specific to D-arabinono-1,4-lactone oxidase EC:1.1.3.-, which is involved in the final step of the D-erythroascorbic acid biosynthesis pathway.
215258	PLN02465	2.36e-45	43	509	89	565	L-galactono-1,4-lactone dehydrogenase
130737	GLDHase	1.64e-36	38	284	49	291	galactonolactone dehydrogenase. This model represents L-Galactono-gamma-lactone dehydrogenase (EC 1.3.2.3). This enzyme catalyzes the final step in ascorbic acid biosynthesis in higher plants. This protein is homologous to ascorbic acid biosynthesis enzymes of other species: L-gulono-gamma-lactone oxidase in rat and L-galactono-gamma-lactone oxidase in yeast. All three covalently bind the cofactor FAD.
396238	FAD_binding_4	2.74e-36	51	186	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW22693.1|AA7	5.39e-09	51	237	61	257
QKX64016.1|AA7	1.22e-08	29	225	18	229
CAE7194773.1|AA7|CBM18	5.76e-08	51	228	135	321
EGX49222.1|AA7|CBM1	5.94e-08	51	225	164	349
CAE7214923.1|AA7	6.76e-08	51	213	63	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7A24_z	3.81e-29	38	284	110	352	Assembly intermediate of the plant mitochondrial complex I [Brassica oleracea]
2VFR_A	1.14e-21	43	220	13	186	Alditol Oxidase from Streptomyces coelicolor A3(2): Native Enzyme [Streptomyces coelicolor A3(2)],2VFS_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Xylitol [Streptomyces coelicolor A3(2)],2VFT_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Sorbitol [Streptomyces coelicolor A3(2)],2VFU_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Mannitol [Streptomyces coelicolor A3(2)],2VFV_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Sulphite [Streptomyces coelicolor A3(2)]
4ML8_A	3.78e-12	23	239	21	239	Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays],4ML8_B Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays],4ML8_C Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays],4ML8_D Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays],4MLA_A Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays],4MLA_B Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays]
4AUT_A	7.27e-10	43	216	24	200	Chain A, Decaprenyl-phosphoryl-beta-d-ribofuranose-2- Oxidoreductase [Mycolicibacterium smegmatis],4F4Q_A Crystal structure of M. smegmatis DprE1 in complex with FAD and covalently bound BTZ043 [Mycolicibacterium smegmatis MC2 155]
6FYG_A	2.21e-09	31	291	25	277	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SGY1|ALO_NEUCR	0.0	1	556	1	556	Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alo-1 PE=3 SV=1
sp|Q6CG88|ALO_YARLI	5.01e-122	34	506	9	514	D-arabinono-1,4-lactone oxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALO1 PE=3 SV=1
sp|O93852|ALO1_CANAL	1.47e-103	31	506	10	543	D-arabinono-1,4-lactone oxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALO1 PE=1 SV=1
sp|Q6FS20|ALO_CANGA	2.43e-99	32	506	6	509	D-arabinono-1,4-lactone oxidase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=ALO1 PE=3 SV=1
sp|Q752Y3|ALO_ASHGO	4.17e-99	38	506	16	513	D-arabinono-1,4-lactone oxidase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=ALO1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in NCU03188-t26_1-p1.