CAZyme Information: NCU02235-t26_2-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU02235-t26_2-p1
• CAZy Family: AA9
• CAZyme Description: class I alpha-mannosidase 1A, variant 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
956		107603.83	5.1513

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002242:3235262-3238246(-)

Full Sequence      

MLPLRIRRYRPFLIGAFIILVLLYHVSQNSDWELSQSALYSPKKAPADSAAKDRLNVEYQ
PPQPPKPTSIAREKQTTTSAQPTPKKETGIRIPQLKTSNEVPGGFGLPTSAPTVGKAHDH
SAAEESHVAVKLPDRPVPEEHVEPTSTKEHWQKPSEWFPVPKESIIKLPTGKPKPIPTVQ
FNFGEESPEAKEKRVARLNKVRAEAQRAWSGYKKYAWGHDELTPVTRISKDPFCGWAATL
VDALDTLWIMGLREEFDEAVEYVKELDFTYSAHRSEIPVFETTIRYLGGFLGAYDVSGGE
KTKAAYKILLDKAVELAEVLMSVFDTPNRMPILYYNWRPSFNENPKRASTRSGMAELGTL
SMEFTRLAQLTGENKYYDAVARITNALEDLQNREDGTALPGIFPENIDASGCNRTAQAAT
NYDNLSDAGKQQVDDATDLDEEPQGYTAGTTVQDIQSGKDPLDLNGVTKRELNRRTPPPR
SSVPEYQPPPWKGAKNQGPPRDAQGMPANWDCVPQGLVAGGWGSESYSMGGSQDSAYEYF
PKQYLLLGGLEDKYRTMHEKVSAAVKKYLLFRPMAPGNPDILFSAKVTSYDHTDQKLNYE
WEATHLTCFLGGMYGLGGKIFGSPEDVEIGRKLADGCAWAYEVMPTGIMPEYSMVLPCAK
ADDCQWNQTAWYNAIDTEAEWRDEQLKKWEVSHAEWVQEVKMLKKEHAEAEEAAAKARSE
QEAKPKNTYQTGLNPGVHQGMQQDVDYHLTKRRLSEDDKIDVAKKVNKLEDELDLNNNIA
GHGPQDQQQKPMSELLLPPEPEKPLSHEEFVEDRIKRENIPPGFVSLNDKRYILRPEAIE
SVFYYYRITGSPIWQDKGWRMFESVIAATRTDIAHSAIDNVAIASTSTSASTSTPTKDKD
EDDNRKQTKPSFTDSMESFWLAETLKYFYLLFAEPDVVSLDEYVFNTEAHPFKRPT

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	206	954	1.1e-182	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	206	954	3	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	3.69e-85	147	955	22	519	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO67971.1|GH47	0.0	5	956	3	882
AEO60003.1|GH47	2.24e-315	5	956	3	898
VBB81906.1|GH47	9.89e-307	5	956	3	971
ERT02678.1|GH47|3.2.1.113	2.58e-282	90	956	110	1043
UQC81050.1|GH47	2.95e-274	7	955	5	1026

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	6.75e-35	208	396	16	193	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	7.09e-35	208	396	16	193	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1FMI_A	7.44e-35	208	396	21	198	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	7.69e-35	208	396	21	198	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
2RI8_A	1.31e-34	196	951	4	470	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P39098|MA1A2_MOUSE	5.86e-35	173	651	158	508	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
sp|O60476|MA1A2_HUMAN	4.39e-34	173	651	158	508	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
sp|P31723|MAN12_PENCI	8.37e-34	178	951	18	505	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|Q8H116|MNS2_ARATH	9.72e-34	197	387	98	279	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	1.11e-33	180	651	24	375	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000001

TMHMM  Annotations     

There is no transmembrane helices in NCU02235-t26_2-p1.