CAZyme Information: NCU00086-t26_1-p1

Basic Information

• Species: Neurospora crassa
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora crassa
• CAZyme ID: NCU00086-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331		36747.10	4.5919

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NcrassaOR74A	10591	367110	833	9758

• Gene Location: location=CM002238:2564812-2565909(+)

Full Sequence      

MNNAFYNPSEGRWSPDVAWWISGTALQAVLDYMHVTGSRDYLSQAHEIIEKQKAPLPWWP
QGDGNFRADSTDDTGWWALAMLRMFDLTGDKQYLTIAMQDEQYIWNYWTDTECGGGIYVD
IKAMTYKNAIANALYIKLAAGLHLRTGDARYLTRALKAHQWFVESGMINAEELVNDGLTQ
DKANGVCFNNEGPTWSYLQGVVIGGLVELFRTTLNETYIRSAATLANAVISSPQLTPPST
GVLTDYACEGTAAGCNYDQQSFKGIFARNLGELDVLIVGRPYRTYLEQNANSAYQKARNA
DDTYGTSWSGPFDGSSLAKQQSAASLWVALL

Enzyme Prediction     

No EC number prediction in NCU00086-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	2	319	1.9e-79	0.8547486033519553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.25e-41	5	324	16	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	2.67e-10	72	326	93	340	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
224250	YyaL	0.002	78	165	474	573	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA27974.2|GH76	1.81e-251	1	331	1	331
ADI12151.1|GH76	1.85e-119	5	331	44	366
QKG20016.1|GH76	6.80e-118	5	331	39	359
AEO57624.1|GH76	1.66e-115	1	331	57	399
AEO69376.1|GH76	3.58e-114	1	331	58	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	1.08e-15	64	298	84	303	Chain A, Lin0763 protein [Listeria innocua]
6RY0_A	5.05e-11	16	268	73	329	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]
6U4Z_A	4.15e-07	5	228	155	391	Crystal Structure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q05031|DFG5_YEAST	4.39e-17	6	276	57	331	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1
sp|Q5ACZ2|DFG5_CANAL	6.83e-15	6	331	52	389	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

There is no transmembrane helices in NCU00086-t26_1-p1.