CAZyme Information: MRET_4371-t46_1-p1

Basic Information

• Species: Malassezia restricta
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia restricta
• CAZyme ID: MRET_4371-t46_1-p1
• CAZy Family: GT69
• CAZyme Description: diacylglycerol acyltransferase family

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516		57748.24	6.6254

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MrestrictaKCTC27527	4544	N/A	138	4406

• Gene Location: location=CP030259:132163-133713(-)

Full Sequence      

MSWARRYLFVSNADNGQTAPLMPIMLELAQRGCQCILVSAAKVLSRVQAIQRLGSFPVQT
EAGSATGAVLKTHPLLLHSLGESPVLTYLNFVEEYPERFHEHCCRKPGDVMGWTKLYTEL
VPDSTDEYLRIVHLVRDAVDALDPDMIIVDNFSPFAVDGVRLTKRPFIETAPGSAMGLAN
RVNPFKQPLAMSGGRSEAGGLSVVHRNTSYVFRWLYFALYDPWSIRRRQFRKDVLRLTAP
SLMDDAIMPPSPGVLPQQIATITFNVAGLDIYAPSAYDRSVFFVGPCFPPQAQPDAQQPA
DDEVIAWMDKMHAEGRRVVCINMGTIYYYQPQDYAHMVQALHMIHEQNPNVAFLWKIAQR
PKHVQNIPSEDEAALPPYVRRLSWIPSMTAVMEHPALAVMMHHGGGNSLNECLAYGIPQF
CISQWVDTHDIGLCIRHSGVGLWSEYSPDFVPEDICSQLLQLVEDKDHTFRHTALSWKLK
TQQAGGTKFAADLIQSYVTDYTYAGGSSKAPMPHAM

Enzyme Prediction     

No EC number prediction in MRET_4371-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	211	496	1.5e-17	0.6204188481675392

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.50e-26	6	494	2	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
273616	MGT	5.63e-12	106	497	65	389	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
178170	PLN02555	1.05e-08	284	487	242	455	limonoid glucosyltransferase
177857	PLN02207	7.81e-07	280	500	239	462	UDP-glycosyltransferase
224732	YjiC	6.19e-06	6	494	3	395	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA52354.1|GT1	0.0	1	516	1	516
AYO45013.1|GT1	0.0	1	516	1	516
SHO78186.1|GT1	7.41e-183	5	516	9	563
AYO44873.1|GT1	4.03e-165	5	516	9	566
AXA52113.1|GT1	1.10e-76	302	516	54	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DU2_A	3.46e-06	273	498	219	415	Structural analysis of EspG2 glycosyltransferase [Actinomadura verrucosospora],5DU2_B Structural analysis of EspG2 glycosyltransferase [Actinomadura verrucosospora]
3WAD_A	4.58e-06	375	465	295	382	Crystal structure of glycosyltransferase VinC involved in the biosynthesis of vicenistatin [Streptomyces halstedii],3WAD_B Crystal structure of glycosyltransferase VinC involved in the biosynthesis of vicenistatin [Streptomyces halstedii],3WAG_A Crystal structure of glycosyltransferase VinC in complex with DTDP [Streptomyces halstedii],3WAG_B Crystal structure of glycosyltransferase VinC in complex with DTDP [Streptomyces halstedii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0D1DZV5|EMT1_USTMA	4.18e-32	92	496	70	560	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	2.83e-30	124	497	104	562	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|A0A411KZY6|BUAB_ASPBU	4.28e-14	8	442	9	415	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|G3FIN9|UGTK5_MANES	6.93e-07	241	489	222	466	Linamarin synthase 2 OS=Manihot esculenta OX=3983 GN=UGT85K5 PE=1 SV=1
sp|G3FIN8|UGTK4_MANES	6.47e-06	241	489	222	466	Linamarin synthase 1 OS=Manihot esculenta OX=3983 GN=UGT85K4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MRET_4371-t46_1-p1.