CAZyme Information: MRET_3246-t46_1-p1

Basic Information

• Species: Malassezia restricta
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia restricta
• CAZyme ID: MRET_3246-t46_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: phosphatidylinositol glycan, class V

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407		44712.70	9.0533

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MrestrictaKCTC27527	4544	N/A	138	4406

• Gene Location: location=CP030255:703091-704314(+)

Full Sequence      

MPPSTTRVLLASVLWRVVCVCLLLVSTHAQPAFDTSGELVRLTLRPGAWDAYWDAWAAPF
VRWDTVYFVAMAERGYVYEQMLAFQPGIVHVLRVMGSVPRVWGAPWSPTCAVLGGAIAAN
LASILAPVLLYRLLRTLTRSDAVAERAALLSVLAPASGTSLSAPTPEPFYSVLALSGLLL
LTHTHTAYQWGAAVCFALATWFRANGVLLCGFLVWHGLYKPVLESWPTRRTSHAISGIAS
ALVSVSPFVAQQWWAYTRLCPGRPWCDARLPLAYTFVQRAYWDVGFLRYWTVAQVPNFVL
AMPVLAVAAYACRPLVSSSVLVVLAPWRARQAPGDVYVYACHTLVLVCILLLASHVQIAL
RMATPGGMPLVWWACAALYERHRGVLVYLLCYSTAAIVLYAGFYPPA

Enzyme Prediction     

No EC number prediction in MRET_3246-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	9	407	4.7e-88	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	5.20e-39	8	407	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	2.71e-09	188	407	190	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA51352.1|GT76	2.16e-302	1	407	1	407
AYO43539.1|GT76	2.30e-254	1	346	1	346
SHO79637.1|GT76	4.36e-136	4	407	8	421
CBQ69964.1|GT76	2.21e-97	7	407	44	473
SJX65610.1|GT76	1.23e-94	7	407	36	465

PDB Hits     

MRET_3246-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP63|GPI18_CRYNB	3.85e-45	6	407	8	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1
sp|P0CP62|GPI18_CRYNJ	3.85e-45	6	407	8	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	1.18e-36	15	407	29	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q5KR61|PIGV_RAT	1.09e-28	47	386	50	428	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q4I0K3|GPI18_GIBZE	4.62e-28	57	407	59	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.010845	0.989112	CS pos: 29-30. Pr: 0.9639

TMHMM  Annotations     

Start	End
7	29
112	134
194	216
231	250
289	311
336	358
385	404