CAZyme Information: MRET_2697-t46_1-p1

Basic Information

• Species: Malassezia restricta
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia restricta
• CAZyme ID: MRET_2697-t46_1-p1
• CAZy Family: GT20
• CAZyme Description: glycosyl hydrolases family 8

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	CP030254|CGC3	40217.15	5.4891

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MrestrictaKCTC27527	4544	N/A	138	4406

• Gene Location: location=CP030254:561719-562865(-)

Full Sequence      

MDARYHQWCSNYMRSSPCGLYCFYNGSGENGDAITCSEAHGYAMLIAVLHGNQNDFDGLL
SFFLSFRNGHGLMKWQVRQNGSGTLYVDEDANDCATDGDIDIATALFLASRNWPQGSSSF
PAGAYGYEAAALSDAVLAHCIHPDLNVPLLGDWCCKDDKENCRLYDSTRSSDFILSSFLL
FHMKHPNPQSRQRWQEVLESTLQVAISQLALYPRSGLLADFLVYDKRHGWHPSKGKHLES
KYDGEMSWNACRTPWRLAHYYAVTGDQRILPLLQTMHQTLMRCNFPSVPAGIRVRDGKAL
VDYSERAFIAPVGYLSYVLGDSSSHLAAIRAMDDEEPGYFGDSIDLVIAEEAMAASTWLS

Enzyme Prediction     

No EC number prediction in MRET_2697-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	4	346	1e-52	0.971875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396020	Glyco_hydro_8	2.81e-11	5	316	8	282	Glycosyl hydrolases family 8.
225940	BcsZ	5.86e-10	34	260	52	254	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA50804.1|GH8	3.82e-279	1	360	1	360
AYO43757.1|GH8	1.28e-265	13	360	1	348
SHO79065.1|GH8	3.76e-214	1	359	1	354
SAM75117.1|GH8	4.38e-140	1	359	1	364
CDR88245.1|GH8	1.56e-136	1	358	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	2.88e-34	1	346	62	396	Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	4.27e-16	5	347	35	372	The crystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	4.52e-16	5	347	41	378	Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19254|GUB_NIACI	4.02e-34	1	346	62	396	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
sp|P29019|GUN_BACSZ	7.03e-16	5	347	91	428	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
sp|P37701|GUN2_RUMJO	1.44e-11	1	348	63	381	Endoglucanase 2 OS=Ruminiclostridium josui OX=1499 GN=celB PE=3 SV=1
sp|P37699|GUNC_RUMCH	2.58e-09	3	348	65	381	Endoglucanase C OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999605	0.000411

TMHMM  Annotations     

There is no transmembrane helices in MRET_2697-t46_1-p1.