CAZyme Information: MRET_2471-t46_1-p1

Basic Information

• Species: Malassezia restricta
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia restricta
• CAZyme ID: MRET_2471-t46_1-p1
• CAZy Family: GT15
• CAZyme Description: glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454	CP030254|CGC1	52148.24	6.4533

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MrestrictaKCTC27527	4544	N/A	138	4406

• Gene Location: location=CP030254:174252-175616(-)

Full Sequence      

MKSTFLSFLGVAMTMATMALATNVRDTRGSISVRHGGSKRSGISSEDLEQMGDQMAARAN
LNLRFNYGRDMVRGVGIGGWLVIENFITPSIYEKAGDDRVIDEWSFGKYVPEEKAKKILK
DHYDNFITEEDFKEIASYGLNHVRVSFPYWGIRTWGDEPYVTLNQYDKLKEAAHWAEKYN
LKMIIELHTVPGGANPYDHGGHKDHFNWLNEQKYEDRWLEILDELVSEFSQSKYPAVSGI
SMVNEPNGDVNQVYGRYKKGYNTVRNSESDSDLIILLGDVFLNPAENDYWHSRFQPPKYQ
NVMTDTHVYRMFDPNSIKLSPEDRIQSYCNMKSGFAEANKHLWALVGEWSPAVNDCAPGL
NGRFEGARYDGSFGDSNYIGSCKGKTGNAKHFSESYKRLLKKSWEAQVDTYEAGSGWIMW
TWRTEHHNADDWSYRQGVRHGWIPKDPTQRDFKC

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	121	425	1.4e-99	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	5.27e-38	72	435	18	373	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.02e-06	124	309	22	195	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA50543.1|GH5_9	0.0	1	454	1	454
AYO43966.1|GH5_9	0.0	1	454	1	454
SHO79766.1|GH5_9	8.97e-221	4	454	5	450
ULM60699.1|GH5_9	7.80e-147	23	450	75	511
CDI55234.1|GH5_9	1.29e-138	17	454	56	500

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	1.22e-74	62	452	4	392	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PB1_A	1.77e-74	62	452	5	393	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PC8_A	4.93e-74	62	452	5	393	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	4.93e-74	62	452	5	393	Chain A, Hypothetical protein XOG1 [Candida albicans]
1EQP_A	5.86e-74	65	452	2	387	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12626|EXG_PICAN	2.90e-82	64	452	41	428	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1
sp|O93983|EXG2_WICAO	2.26e-75	65	452	35	422	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q12725|EXG_YARLI	4.15e-74	54	452	19	415	Glucan 1,3-beta-glucosidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=EXG1 PE=3 SV=2
sp|P29717|EXG1_CANAL	9.27e-74	62	452	43	431	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q875R9|EXG_LACK1	2.88e-72	65	452	41	433	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002720	0.997239	CS pos: 21-22. Pr: 0.9706

TMHMM  Annotations     

There is no transmembrane helices in MRET_2471-t46_1-p1.