CAZyme Information: MRET_1696-t46_1-p1

Basic Information

• Species: Malassezia restricta
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia restricta
• CAZyme ID: MRET_1696-t46_1-p1
• CAZy Family: GH5
• CAZyme Description: beta-1,4-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432	CP030253|CGC2	47745.08	9.0254

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MrestrictaKCTC27527	4544	N/A	138	4406

• Gene Location: location=CP030253:143374-144672(-)

Full Sequence      

MLGLPWGVLLGVLLWVACIRVRAIHQRTAMVVVLGDVGRSPRMCYHIASLVRHGWTVYVA
GHFDTQLPRYLCTPQVHRVPLWSPPSFFSKLPRAIFVLVAAVKVPMQTLSLWLALVARTP
KPAVVLVQTPPAIPTLMVVQCACLLTRSRLFLDWHNLAYTLLALRLGPHSPLVRVSETLE
RLFGRHADAHLFVTQAMLRHLAKRWHLRGAMAVLHDRPPAHFHRLSEADAKAFFDRVGPM
LCAGDRGGAALAVTSTSWTPDENMHLLLEAASMYEERACTMPLRSLVIVITGKGPLREIF
ERTIRQRTQAWKHVRISTAWLSADDYPRLLGAADVGISLHSSSSGLDLPMKVVDMLGCGL
RVCALSFACLDELIQPGVNGDVFSDAQGLASCLERLANAPSDALHTPFLGAEPRSWDALW
DQVVVPLLPSNT

Enzyme Prediction     

EC	2.4.1.142:10	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	27	426	7.6e-130	0.9929411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	1.53e-157	26	428	3	411	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	3.07e-124	27	390	5	364	transferase, transferring glycosyl groups
223515	RfaB	2.63e-14	43	423	1	370	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340825	GT4_WbuB-like	1.85e-12	36	398	12	361	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
340831	GT4_PimA-like	1.86e-12	77	424	32	358	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA49698.1|GT33	0.0	1	432	1	432
AYO43069.1|GT33	0.0	1	432	1	432
SHO77286.1|GT33	3.18e-162	20	431	19	430
CED84249.1|GT33	5.41e-110	3	432	20	516
SAM83600.1|GT33	8.31e-109	27	396	44	515

PDB Hits     

MRET_1696-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9BT22|ALG1_HUMAN	1.13e-79	27	428	33	461	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG1 PE=1 SV=2
sp|Q8L7M0|TUN_ARATH	4.56e-79	29	428	7	455	UDP-glycosyltransferase TURAN OS=Arabidopsis thaliana OX=3702 GN=TUN PE=2 SV=1
sp|Q5R7A2|ALG1_PONAB	6.25e-79	27	428	33	461	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Pongo abelii OX=9601 GN=ALG1 PE=2 SV=1
sp|O13933|ALG1_SCHPO	1.63e-78	26	431	24	423	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg1 PE=3 SV=2
sp|Q921Q3|ALG1_MOUSE	1.55e-77	25	428	31	461	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995606	0.004404

TMHMM  Annotations     

Start	End
2	24