CAZyme Information: MRET_0653-t46_1-p1

Basic Information

• Species: Malassezia restricta
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia restricta
• CAZyme ID: MRET_0653-t46_1-p1
• CAZy Family: GH16
• CAZyme Description: dolichyl-phosphate-mannose-protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779	CP030251|CGC8	88861.04	7.3161

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MrestrictaKCTC27527	4544	N/A	138	4406

• Gene Location: location=CP030251:1116219-1118558(+)

Full Sequence      

MVSEAASQLRRRTAPASAGKTKSSQKGALNDRVPHTPVQAGPRHSAWVNAGITLALLIAA
LLVRVIFIHYPDEVVFDEVHFGKFASYYIKGEYFFDVHPPLAKLMIAAMAWLAGFDGKFE
FDEIGDSYVEHNVPYRMIRLLLAIVGALQVPLVFQILRETGVSSLMSIVAALAILADNGH
VLQSRLILLDAPLVLFMLCSLYCYIRFYAQRYNPFKAAWWTWLSLTGVSLACTISCKMVG
VLTFATIGGAVILDLWNLLDIRRGLSMRVFVKHFCARAMCLIILPFLIYLGFFYIHFEIL
TQTGSGDTFMSNEFQQTLNGNEFLQSPVDLHAFDTITLRHRGTNAYLHSHADRYPLEYED
GRISSQGQQVTAYEHQDANNQWQILPLDPVDNEDGSFNETLRIIHHNQYIRLLHVNTSSY
LRSHDVASPLMPTNMEFTTVPADTFDQADEETVADTVFRVSIDGIKNDDVIWRTRVDSVR
LIHNSTGVAMWTHSDQRLPDWGFQQLEVNGNKHPKDRTTLWNAMDVYPDPASPLYESRSD
ISQEPLAPKKRSFWRKYTELQSTMLSHNNQLTDKHPYDSRPQSWPIMYDIVSYWTKETTR
EQVTFLGNVVSWWTSSLAVLAFVSIFVTDLLCRRRGLFYLSTPDRSRYLHTTGFFVYAWA
CHYLPFFLMHRQLFIHHYLPAHACSVLVLGGVLDFVTSRSIDLPLSPAGPALQPEQLRPT
MRRRYTQLAQPVAFIVALSLVAMFHYLAPFTYGNVGLERAQVQARRMLSSWRLQFASDV

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	56	297	2.1e-68	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	63	775	37	697	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.18e-75	63	301	10	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	2.13e-64	555	769	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	1.00e-22	348	520	13	184	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
224720	ArnT	5.36e-09	73	292	40	224	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA48177.1|GT39	0.0	1	779	1	779
AYO41118.1|GT39	0.0	1	779	1	779
SHO78314.1|GT39	7.20e-316	4	775	2	768
SAM85685.1|GT39	2.18e-264	10	775	12	766
CBQ70214.1|GT39	2.34e-264	44	776	48	769

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	4.95e-100	22	698	5	676	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	6.59e-85	60	694	75	694	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6ZQQ_A	1.41e-12	345	522	32	199	Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_B Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_C Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_D Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46971|PMT4_YEAST	1.39e-193	43	765	51	751	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q59X23|PMT4_CANAL	2.82e-191	50	768	49	747	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	1.84e-189	71	775	80	774	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|Q8R2R1|POMT1_MOUSE	5.99e-111	54	771	42	740	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1
sp|Q99PR0|POMT1_RAT	1.20e-110	54	771	42	740	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999928	0.000075

TMHMM  Annotations     

Start	End
46	68
93	115
135	157
186	208
220	253
273	295
605	627
647	669
728	750