CAZyme Information: MGL_3855-t26_1-p1

Basic Information

• Species: Malassezia globosa
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia globosa
• CAZyme ID: MGL_3855-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
758	AAYY01000015|CGC2	82572.25	7.3203

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MglobosaCBS7966	4286	425265	0	4286

• Gene Location: location=AAYY01000015:184215-186491(-)

Full Sequence      

MNYRHLVIDESRNYADELWSKDQQRALEAIANAIISPLTPKEKESFLNTLPSDLSAEDKA
RANEYADLSFSDLPNGVNLIAMHVHETVSFTLRSLITLLLKSLATRAGCLALIGRVGPVW
DVDQDAIVTTLLAWRTSPIQVLRLGQFGLIGLTMMVFYRHFEKATEAIGYPTGPTDDWKT
PPGFEEQTAIPHYNFQFLNDNLPLSPTSEPIDLETDVVVVGSGCGGGVVAAYLAERGLKV
VVVDKGLYVRPEEMPLTQSFGFDQMFERLGFVPSSTMSIGVLAGSGFGGGSTINWGATLT
PRYFLRQAWSKKYGMPYFESALFTQDLDACAHRMGTTDNITHNRANTLLMLGARRAGQPV
SAVPQNNGNLPHYCGKCTFGCPSGHKHGTLMTYLRDAAEHGAQFLTHCDVERVLMEDGKA
TGVMGHVKGQSVRIHGKQGVVISAGSVNTPAILLRTPELKKNKQIGEHLHLHPVAFVHGF
YDIPVYPWEGGSLTTVSNAAELVDPHGWGAKIEVMASAPSLFCAILPFQNSAQHKKLASR
YRYSYTAIVLVRDRDGGRVKLDKYGRALMDYNLSKFDQKSMLEGVKRATEIHMNAGASAI
AVTQFDVPLYECPKNKLPSSVPEKLLPGSYPFDSLPPQGDVMHPSFVEFQKQIERAGFST
LRCTLGSAHQMGSCRMGADPTTSACDPRGRLRGASRLWVADGSVLPEASGVNPMLTILGT
SRGIARNIAEELGVARSDDLASTTSTSIPAPSPPRAHL

Enzyme Prediction     

No EC number prediction in MGL_3855-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	214	739	2e-45	0.5161812297734628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	6.38e-47	262	474	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	3.07e-29	230	736	23	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	9.95e-22	557	718	5	137	GMC oxidoreductase. This domain found associated with pfam00732.
274888	Rv0697	6.67e-14	284	717	81	475	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	3.64e-07	405	478	219	287	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	8.96e-106	107	738	127	740
QGI77692.1|AA3_2	3.27e-09	216	733	15	535
CCT64188.1|AA3_2	3.27e-09	216	733	15	535
QGI60495.1|AA3_2	3.27e-09	216	733	15	535
QGI91399.1|AA3_2	3.27e-09	216	733	15	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3LJP_A	3.13e-06	212	718	11	516	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	9.43e-06	212	718	11	516	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
2JBV_A	9.43e-06	212	718	11	516	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ8|FAO1_LOTJA	1.06e-72	201	732	223	744	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q9LW56|FAO3_ARATH	5.05e-72	164	732	170	740	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|B5WWZ9|FAO2_LOTJA	7.18e-71	213	732	237	746	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|Q9ZWB9|FAO1_ARATH	3.91e-69	19	738	28	758	Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana OX=3702 GN=FAO1 PE=3 SV=2
sp|O65709|FAO4A_ARATH	4.76e-65	205	732	213	722	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000006

TMHMM  Annotations     

There is no transmembrane helices in MGL_3855-t26_1-p1.