CAZyme Information: MGL_3822-t26_1-p1

Basic Information

• Species: Malassezia globosa
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia globosa
• CAZyme ID: MGL_3822-t26_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556	AAYY01000015|CGC1	62929.20	6.5303

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MglobosaCBS7966	4286	425265	0	4286

• Gene Location: location=AAYY01000015:117225-118895(-)

Full Sequence      

MVYFSHKRVSLPPAGWIRAARFHGTKVLGTLIFEWDQSKSDLKLLLDGPHPKWRTPVRVE
LSEHFADQLVLLAAAYDIDGFLVNVETSLQLNPFQNPILQRLDRLHNAVRLRRWVQYFRE
KGQQSRPVWHVVWYDSVTYPEGQLAWQDAMTIANAPYIQAASSAFINYTWSHPERCKHGF
LNPCLEHTVSMADHCLFPRYNVFMGVDVFGRNCLGGHDATKAIDLLGLHLGNEGFASGKR
YNLSVALFAPGWTWEHDSPPARSWDAWWKEDCEFWEDGLHCITKYFPNRAYLWHGDSTHG
YGFRTNFCLGSGTHWFVQGRNVYHDKEHGWSDQGVSAPKPTLAWPNVKYVLNESGTYVKA
AVHTHLSCEDAWSGSQSLCVEVSSESYIPILALAPMPREASSRSATLRVCAKGAKIVPCI
HVGSRLLRGCESIQRVNGWQLYKVELTLPEDIYENEVHVILGVSGSVLIGQIEISSSQYL
EADATWHNGVLSWSDVVPWATCYEVYTVREDPVWIGTVSHTLSRNQTIMYGDEETIAQIQ
SVGAWPDEAPILAMPS

Enzyme Prediction     

No EC number prediction in MGL_3822-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	1	316	1.9e-48	0.9015873015873016

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397623	Glyco_hydro_85	9.25e-80	1	312	19	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
119364	GH85_ENGase	3.09e-63	1	344	36	333	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
227068	COG4724	5.41e-24	1	378	113	444	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA48594.1|GH85	2.52e-245	1	556	82	630
AYO41148.1|GH85	2.17e-222	1	504	82	577
SHO78346.1|GH85	1.28e-192	1	556	81	639
SAM80897.1|GH85	3.41e-73	2	477	130	724
CDI52637.1|GH85	2.11e-67	1	382	131	620

PDB Hits     

MGL_3822-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F4JZC2|ENAS1_ARATH	6.81e-36	2	342	102	377	Cytosolic endo-beta-N-acetylglucosaminidase 1 OS=Arabidopsis thaliana OX=3702 GN=ENGASE1 PE=1 SV=1
sp|Q9SRL4|ENAS2_ARATH	3.41e-35	2	306	107	359	Cytosolic endo-beta-N-acetylglucosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=ENGASE2 PE=1 SV=1
sp|Q8NFI3|ENASE_HUMAN	1.17e-31	2	380	162	467	Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=ENGASE PE=1 SV=1
sp|Q8BX80|ENASE_MOUSE	2.05e-31	2	378	154	457	Cytosolic endo-beta-N-acetylglucosaminidase OS=Mus musculus OX=10090 GN=Engase PE=1 SV=1
sp|P0C7A1|ENASE_CHICK	3.97e-26	2	381	160	460	Cytosolic endo-beta-N-acetylglucosaminidase OS=Gallus gallus OX=9031 GN=ENGASE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGL_3822-t26_1-p1.