CAZyme Information: MGL_3350-t26_1-p1

Basic Information

• Species: Malassezia globosa
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia globosa
• CAZyme ID: MGL_3350-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		40220.31	5.4902

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MglobosaCBS7966	4286	425265	0	4286

• Gene Location: location=AAYY01000013:36202-37402(+)

Full Sequence      

MEAKYRQWCSTYMRSSPSGLYCFYNGSGDNGDAVTCSEAHGYAMLIAVLHGNQVDFDGLL
TFFLNFRNEHGLMMWQVRMNQSGALYVEEDARDCATDGDIDIATALFQAQRVWPNGSSNF
PAGAYGYEAAALSDALLAHCVHPELHVPLLGDWCCTDSKENRRLHDSTRSSDFILSSFLL
FHMKHPNPESRQRWQQVLEATLQVAISQLDVNPRTGLIADFLVHDKRHGWHPSKGKHLES
KYDGEMSWNACRTPWRLAHYYAVSGDQRILPLLQTMLKTLLNANFPAVPAGIRIRDGKGL
ADYSSRAFIAPVGYLAYALGDGASHMTAIRALDDEEDEYFGDSIDLVIAEEAMAAPMWLA

Enzyme Prediction     

No EC number prediction in MGL_3350-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	4	346	6.9e-53	0.971875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396020	Glyco_hydro_8	2.74e-15	5	348	8	315	Glycosyl hydrolases family 8.
225940	BcsZ	3.61e-07	29	116	45	134	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA50804.1|GH8	4.11e-233	1	360	1	360
SHO79065.1|GH8	7.68e-230	1	359	1	354
AYO43757.1|GH8	1.27e-224	13	360	1	348
SAM75117.1|GH8	1.02e-138	1	359	1	364
CDR88245.1|GH8	6.73e-138	1	358	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	5.39e-33	1	346	62	396	Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	7.54e-19	1	347	31	372	The crystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	8.13e-19	1	347	37	378	Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19254|GUB_NIACI	1.05e-32	1	346	62	396	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
sp|P29019|GUN_BACSZ	6.58e-17	5	347	91	428	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000005	0.000029

TMHMM  Annotations     

There is no transmembrane helices in MGL_3350-t26_1-p1.