CAZyme Information: MGL_2744-t26_1-p1

Basic Information

• Species: Malassezia globosa
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia globosa
• CAZyme ID: MGL_2744-t26_1-p1
• CAZy Family: GT15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	AAYY01000009|CGC1	38520.09	6.4159

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MglobosaCBS7966	4286	425265	0	4286

• Gene Location: location=AAYY01000009:585183-586251(-)

Full Sequence      

MYVRLLVVTCLCVMHVQALNYSMCQEWSGSDFFNHFYWWSGPDPTHGLVDYVNQDVSRRS
NLSYVDQNTGNFVLNVDTGDPVPRNGNWSHLVRRSNRIHSNHKFGDGFYILKLARMPTGC
GTWPAFWTSTGSTWPDGGEIDIIENANGDGPNLSSLHAGANCNVDQKFNNNQQGYVIMAS
LRFLETYAYSETSCVRTAPINRDARVSLTTTIPLARASTTGTLSFTAISSPSPNMKKLLT
RNYSGGGWFAMMRDTRVNGTGIGVYFWHKDTDRDQMPPQVAAPIHEAPTSLDGDHMEKWG
KPQAYFGYNDGSNIQCDFENKFGLHEIIFDTTYVFVLPWVCVD

Enzyme Prediction     

No EC number prediction in MGL_2744-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	61	176	1.9e-32	0.4585152838427948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185690	GH16_fungal_Lam16A_glucanase	1.78e-59	20	332	1	245	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
185693	GH16_laminarinase_like	2.52e-11	114	163	86	140	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185691	GH16_Strep_laminarinase_like	3.63e-07	121	163	106	158	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185694	GH16_CCF	5.43e-05	114	180	121	176	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
395585	Glyco_hydro_16	7.61e-04	97	142	24	67	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA50011.1|GH16_1	1.18e-118	12	332	11	291
AYO43006.1|GH16_1	1.18e-118	12	332	11	291
SHO77213.1|GH16_1	2.00e-79	20	332	21	291
CDI52769.1|GH16_1	6.58e-49	16	330	23	314
CDS82344.1|GH16_1	5.20e-47	4	330	10	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CL2_A	3.60e-30	20	333	2	253	Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium],2W39_A Chain A, Putative Laminarinase [Phanerodontia chrysosporium],2W52_A Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium]
2WLQ_A	1.87e-29	20	333	2	253	Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium],2WNE_A Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium]
3WDU_A	2.54e-28	29	333	11	250	The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_B The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_C The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_D The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila']
3WDT_A	2.59e-28	29	333	12	251	The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_B The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_C The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_D The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDV_A The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_B The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_C The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_D The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDY_A	1.78e-27	29	333	10	249	The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_B The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_C The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_D The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9USW3|YHZ7_SCHPO	4.61e-27	17	333	125	374	Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21B10.07 PE=3 SV=1
sp|B0XTU6|EGLX_ASPFC	8.45e-26	17	333	28	276	Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_029980 PE=3 SV=1
sp|Q4X084|EGLX_ASPFU	8.45e-26	17	333	28	276	Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_2G14360 PE=3 SV=1
sp|A2QBQ3|EGLX_ASPNC	9.40e-26	13	167	19	168	Probable endo-1,3(4)-beta-glucanase An02g00850 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g00850 PE=3 SV=1
sp|B8N7S7|EGLX_ASPFN	3.21e-24	20	167	30	172	Probable endo-1,3(4)-beta-glucanase AFLA_105200 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_105200 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000196	0.999783	CS pos: 18-19. Pr: 0.9801

TMHMM  Annotations     

There is no transmembrane helices in MGL_2744-t26_1-p1.