CAZyme Information: MGL_2676-t26_1-p1

Basic Information

• Species: Malassezia globosa
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia globosa
• CAZyme ID: MGL_2676-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521		57995.81	7.1898

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MglobosaCBS7966	4286	425265	0	4286

• Gene Location: location=AAYY01000009:442821-444386(+)

Full Sequence      

MRIGTYAPRDEDVVLTPSSAHSVLNLRRWLELLGSELDYGYTTTEQPRGNSHILHSRARV
LGGCSSHNTLISFFPFDADLDNWRDYHGCPDWGAKAIQPYGSRLKMNIVPIAPQQRNHVV
RDWVKASAEATGAPVMEDMNAQIAYRGGFDQAVGFFNISYDPYNGHRSSASTAYMHPIMP
HGATPRKNLHLFLETWVRALEFDAHDPLRVRGVRAEQKNGTSSVIRARREVILCAGAFDS
PRLLLLSGIGPKSELEAIGIPCRHDLPGVGLNLNDHPESIIIWETRDTPSETVMSSDACL
FLRTQPRDAEPVPHPGPDLMFHIYQVPFTENTARQGYPVPKHAICMTPNAMRSRGRGKVS
LANADPTTKPLIDFKYFQDEDHYDERLMVEGIKIARKVAEHQLFRQHLVREVAPGPACQS
DADISAYARSVAHTVYHPAGTCRMGTPPSSHAPASEDARTVVVDQRDLKVVGMKGLRVCD
ASVLPTLPSVNPMLTILMVAERGAELIRNDAWVNGERRTDW

Enzyme Prediction     

No EC number prediction in MGL_2676-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	38	515	1.8e-74	0.4320388349514563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.80e-90	34	511	59	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	7.29e-85	38	508	64	532	choline dehydrogenase; Validated
274888	Rv0697	5.52e-51	39	508	64	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.66e-38	354	502	2	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.42e-24	57	278	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYO43781.1|AA3_2	0.0	23	521	63	557
AXA50552.1|AA3_2	0.0	23	521	65	559
SHO77144.1|AA3_2	8.10e-309	17	521	57	563
SJX60469.1|AA3	9.97e-269	23	521	100	597
CBQ67832.1|AA3	5.74e-268	23	521	100	597

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	9.52e-91	23	509	55	528	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.34e-90	23	509	55	528	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	3.72e-90	23	509	55	528	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
5OC1_A	1.72e-37	35	510	56	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.07e-36	35	510	57	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	4.90e-90	23	509	55	528	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q1QXE1|BETA1_CHRSD	1.76e-53	32	508	59	536	Oxygen-dependent choline dehydrogenase 1 OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=betA1 PE=3 SV=1
sp|Q4A0Q1|BETA_STAS1	6.38e-52	38	508	63	534	Oxygen-dependent choline dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=betA PE=3 SV=1
sp|Q9X2M2|BETA_STAXY	8.39e-50	38	508	63	534	Oxygen-dependent choline dehydrogenase OS=Staphylococcus xylosus OX=1288 GN=betA PE=3 SV=1
sp|Q8CMY2|BETA_STAES	1.95e-49	38	508	66	539	Oxygen-dependent choline dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGL_2676-t26_1-p1.