CAZyme Information: MGL_2150-t26_1-p1

Basic Information

• Species: Malassezia globosa
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia globosa
• CAZyme ID: MGL_2150-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
844	AAYY01000007|CGC1	91655.43	5.7305

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MglobosaCBS7966	4286	425265	0	4286

• Gene Location: location=AAYY01000007:49899-52433(+)

Full Sequence      

MLGLANQDTAFIFDKVENNRAKTASGKPTWASLVNLTDYSVRGIDATTNPFCAAGSTLGN
GSYIVVGGNSAISYGGINVKNQDGSISSGPAAPYQDYDGRRVVRLMQPNEDSSQLEWIDE
YNSPNQMDSPRWYPGVEGLADGSVVLIGGATNGGFINRNYPNVDPAYATDNPNPTPGKWD
QGGANPSYEFWPPTNKPKPAVHDFMVKTSGLNMYAHTYLMPSGRIFMQANYSTTLWDWQK
DSYHDLPDMPDQIIRVYPASGATAMMPLTPANKYTPTILFCGGFNNITDEQWGDYKAPRV
NMFEQPGSTDCSSITPENADGSNVENVQYVREETLPEPRSMGQFIHLPTGQMVIVNGASR
GVAGYGNTTWNTAKDKQGNVVHMEGMSQKPTYRPVLFDPEQPKGKRLKYEGFGSSKIARL
YHSSAILVPDGSVLVAGSNPHMDVARLPPNDQIDSQYEAFNTTYVLEQWYPEYYFEPRPK
PQGMPDVIKYGGKSFNVTIDANYMNPDNNANDMANKTKFMVIRPGFSTHAVNFGQRSLQL
ENSYEVHHDGSVTFIVNPMPTNMNIFVPGPALLFATVNGIPSHGKYVFLGGKGLGDVPLN
LKPGDEPPRLPAPVNNNNFQKNAPSPGSRTDDDDGLSGGAIAGIVVGVVVGSVLLAALAF
LLWRMKRNQQNAANYASIGRPASTQTMGTTPNAWTRVGTPYSAPHAAPTMQTNESRASLL
GSTTNVSMLPHDAAEAPLSTVIPITGMTKSQPASEFSASTPQSTSQALAPPMFGPRPLMT
SESTNEVQTYYVPPSTSQGPVLMPESTTHWNDIPARMTGPRDMPGSNLQHHLIASSNRYP
TPDE

Enzyme Prediction     

EC	1.2.3.15:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	1	600	1.6e-222	0.9413854351687388

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401164	DUF1929	1.71e-22	485	587	3	89	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
199882	E_set_GO_C	5.97e-21	473	589	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
399910	Glyoxal_oxid_N	2.25e-17	48	283	65	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYO41394.1|AA5_1	0.0	1	832	36	864
AXA48404.1|AA5_1	0.0	1	832	45	873
SHO78428.1|AA5_1	0.0	1	840	44	900
CDU24204.1|AA5_1	4.57e-227	1	708	54	736
SJX66177.1|AA5_1	2.41e-224	1	736	54	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UNM_A	1.23e-11	119	587	245	612	Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans],4UNM_B Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans]
5LXZ_B	5.75e-10	119	587	234	601	W288A mutant of GlxA from Streptomyces lividans: Cu-bound form [Streptomyces lividans TK24]
5LQI_A	5.79e-10	119	587	239	606	W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326],5LQI_B W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01772|GLOX_PHACH	2.93e-58	4	590	44	550	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	9.66e-31	131	589	197	593	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|Q3HRQ2|GLOX_VITPS	1.17e-30	33	589	78	521	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	2.01e-30	30	587	155	612	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|D4AUF1|WSCD1_ARTBC	7.50e-23	42	598	475	914	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000024

TMHMM  Annotations     

Start	End
641	663