CAZyme Information: MGL_1756-t26_1-p1

Basic Information

• Species: Malassezia globosa
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia globosa
• CAZyme ID: MGL_1756-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483		53876.94	6.4273

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MglobosaCBS7966	4286	425265	0	4286

• Gene Location: location=AAYY01000006:36209-37660(+)

Full Sequence      

MMSGASVLPRVQKIQKLGSYPVQTEANPTDSMLKTYPIVFVSLGTSPVLSYLDYVDEQPE
RFHSHCCAKPGKVMGWVQLYKEVVPDSTDEYLRMTHLVRDYVEKFDADMIIVDNFSPFAV
DGVRLTKRPFIETAPGSVMGVASQVNPFKQPLPMSGGRSGEGGLFVILSNFIFIFNWLYF
YLFDPWSTRRRKFRKEVLKLSTPNPLDDAIMPPAPGVLPQQISTLAFSVAGLDIYASNAY
DKSVFFVGPCFVPNALPDTNANAPTPVDDPVLAWMDELYAQNKRVVCINMGTIYYYLRKD
YDNLLRALHMLHERMPNVAILWKIPDRSQDVQPIPKAEEANLPSFIYRVAWIPDMFKVMQ
HPALGVVMHHGGGNSLNEALAYGVPQFCVSQWVDTHDIGLCIQNSGVGLWADHSPEFIPE
DVSSKLATLLEDKGLGFRHRALAWKLKTQQAGGTSFAADVIQSYVSGYTFEGGNSKAPVA
NAM

Enzyme Prediction     

No EC number prediction in MGL_1756-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	172	464	2.5e-19	0.6282722513089005

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.41e-25	94	461	89	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
273616	MGT	4.38e-09	89	466	75	391	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
178170	PLN02555	4.35e-08	247	455	242	456	limonoid glucosyltransferase
177813	PLN02152	1.28e-07	274	459	254	444	indole-3-acetate beta-glucosyltransferase
177830	PLN02173	3.71e-06	225	394	198	366	UDP-glucosyl transferase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYO45013.1|GT1	9.69e-251	1	483	37	516
AXA52354.1|GT1	1.12e-249	1	483	37	516
SHO78186.1|GT1	1.55e-178	1	483	41	563
AYO44873.1|GT1	2.91e-169	2	483	42	566
AXA52113.1|GT1	2.06e-84	260	483	45	268

PDB Hits     

MGL_1756-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0D1DZV5|EMT1_USTMA	3.34e-30	69	463	86	560	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	3.71e-29	38	464	59	562	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|A0A411KZY6|BUAB_ASPBU	3.56e-13	70	452	81	463	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|G3FIN8|UGTK4_MANES	3.53e-07	232	456	241	466	Linamarin synthase 1 OS=Manihot esculenta OX=3983 GN=UGT85K4 PE=1 SV=1
sp|G3FIN9|UGTK5_MANES	6.19e-07	232	456	241	466	Linamarin synthase 2 OS=Manihot esculenta OX=3983 GN=UGT85K5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000003

TMHMM  Annotations     

Start	End
161	183