CAZyme Information: MGL_0392-t26_1-p1

Basic Information

• Species: Malassezia globosa
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia globosa
• CAZyme ID: MGL_0392-t26_1-p1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
695	AAYY01000001|CGC5	76637.97	8.2711

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MglobosaCBS7966	4286	425265	0	4286

• Gene Location: location=AAYY01000001:858635-860722(+)

Full Sequence      

MAIVSRRASTVLLRLFALFLVGTVIVLMLVRSHFRVDRSAYVLETELGTWDEIRASKRPA
VLDHEHVMASSPPDLLPPEKVPRIIHQTWKTDMLPAKWASVREECAKMMPDYEYMLWTDQ
SSREFIEREYSWFLPTFDSYPYNIQRADAIRYFVLHKFGGVYMDLDIGCRRRLDPLLRFD
VIVPKTIPVGVSNDLMFAVPGHPYLDLLIHSLSTFNHYFFTHYATVMFSTGPMFVSAMYR
VFVQRNGIVQPSSPSALDRGFEGVRVLPKSLYGKNLSPSDAPDSFFIHMYGSSWHANDAG
PLIFLRKYGYLLLFIGMLIVVIGMRRACLVALAHVLKLVTSFASSLGSHAGFRADSNRGS
SYISLSTTASSSTPMGSKRRELPPSSHFAPIPSTDWFVSSRPSDVEAKIAPSPVHGTTPP
VPTFSMNDSPSVYEPSGMLHLPSEPVIKSASQISRSSSPLPQPPLATSANVNARENVDAL
GHASTHMNSSDATVEPSFQRRNSDTNAPLPTYYVGNSVPSSNRFSLSDGGARSPSMPSTG
RSNPLKRLSSSTMQTLSTLLPPPMRRSARSSHSDPDEASESLLSLGVDSADGLTRTISRQ
SEDYRSEWDSLVQDMSESTLRSPTLGPAVSPTPQLIEMPDAASSNSKMNVSGLLRRPHPA
DPFRTATPGVSAGPTDADLNPSQYPYSSHPSYLHN

Enzyme Prediction     

No EC number prediction in MGL_0392-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	98	177	1.3e-22	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.81e-51	79	315	80	308	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.44e-25	95	177	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA49912.1|GT32	9.23e-191	1	670	1	592
AYO42588.1|GT32	7.18e-190	1	670	1	592
SHO77529.1|GT32	8.41e-165	5	678	5	584
CDI52367.1|GT32	3.25e-138	2	435	3	453
CDR87151.1|GT32	3.66e-130	2	329	3	374

PDB Hits     

MGL_0392-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	9.94e-64	79	318	62	285	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	4.17e-62	81	308	82	295	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	7.99e-61	81	318	57	278	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	3.14e-58	73	299	46	256	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	2.66e-57	77	299	58	264	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000013	0.000016

TMHMM  Annotations     

Start	End
12	34
221	243
302	324