CAZyme Information: MGG_05464-t26_1-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: MGG_05464-t26_1-p1
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	CM001231|CGC34	43246.78	6.1588

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Poryzae70-15	13184	242507	359	12825

• Gene Location: location=CM001231:5309846-5311063(+)

Full Sequence      

MTRLATLITLAGLLAVSPGAYAQRNRNDTGGSTGAEGLNSLAVKAGLLYFGTASDTRNFA
DEPYMSVVNNTNEFGMIVPENSMKWEATEKEPGRFSFANADRVRALTKANGQMLRCHALT
WHSQLPNFVKTTAWTRDTLTAAIESHISNEVGHFAGDCYAWDVVNEAVNENGSFRDSPFH
RTLGTDFLAISFRAAAAADPNAKLYYNDFNIETPGPKANAAMGIVRLLKEQGVRIDGVGF
QGHLTVGSTPSRAQLASQLQRFADLGVEVTYTELDIRHKSLPVSSRAAQDQARDYVSVIG
SCLDVTACVGVMVWQPTDKYSWIPETFPGTGDACLFDANMNPKPAYTSVSSLLAAAAATA
PASVVPPASVTTSKTPIQAGAGRETVSIAGLTLALSSLAFGMFML

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	44	349	1.6e-96	0.9636963696369637

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	1.68e-134	38	346	1	305	Glycosyl hydrolase family 10.
214750	Glyco_10	1.13e-108	83	347	1	261	Glycosyl hydrolase family 10.
226217	XynA	1.07e-74	10	346	6	334	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAN60060.1|GH10	9.02e-294	1	405	1	405
QBZ55005.1|GH10	5.00e-291	1	405	1	405
AUS45856.1|GH10	4.93e-150	32	360	16	349
UQC79300.1|CBM1|GH10	9.92e-139	38	355	20	338
AEO63155.1|GH10	3.63e-138	1	353	1	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	3.24e-116	37	355	2	319	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	8.46e-112	35	349	22	335	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3U7B_A	2.01e-106	35	348	2	319	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]
3WUF_A	7.68e-92	38	353	5	312	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	1.97e-89	38	353	5	312	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8J1Y4|XYN5_MAGGR	1.60e-294	1	405	1	405	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1
sp|G4MLU0|XYN5_MAGO7	1.60e-294	1	405	1	405	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1
sp|P79046|XYN1_HUMGT	9.03e-127	38	354	21	338	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1
sp|Q5ZNB1|XYND_TALFU	8.22e-109	38	349	21	330	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|B3A0S5|XYNA_FUSO4	1.03e-105	35	348	2	319	Endo-1,4-beta-xylanase A OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) OX=426428 GN=FOXG_17421 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000257	0.999716	CS pos: 22-23. Pr: 0.9792

TMHMM  Annotations     

There is no transmembrane helices in MGG_05464-t26_1-p1.